Peptide Profile
Intermedin (Adrenomedullin-2)
A powerful peptide hormone that protects your heart and blood vessels while managing stress and inflammation naturally.
Dose Range
As prescribed-As prescribedmg
Frequency
Once daily
Route
As directed by healthcare provider
Cycle Length
Ongoing/indefinite
Onset
Moderate (1-2 weeks)
Evidence
Limited
Compound Profile
Scientific & Efficacy Data
C15H25NO5 (precursor compound)
Molecular Formula
299.36 g/mol (precursor)
Molecular Weight
Approximately 2-6 hours (varies by route of administration)
Half-Life
Varies by route of administration
Bioavailability
148498-78-6
CAS #
114843
PubChem ID ↗
Developed By · 2001
Research Team
Academic Research Institutions
Primary Benefits
Supports healthy cardiovascular function and heart protection
Reduces oxidative stress and inflammation throughout the body
May support cognitive function and mental clarity
Amino Acid Sequence
GPRPMGLVMVVGTGTGAEVDAQKPPPGTVCNFTAIWKTVQVDosing
How much
do I take?
Timing
Best time to take
Use Intermedin (Adrenomedullin-2) at the same time each day for optimal results. Consistency in timing helps maintain stable levels and maximize therapeutic benefits. Follow your healthcare provider's specific instructions.
With food?
Intermedin (Adrenomedullin-2) can generally be used with or without food. If you experience any discomfort, try taking it with a light meal. Follow specific guidance from your healthcare provider.
If stacking
Intermedin (Adrenomedullin-2) should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
Adjusting Your Dose
Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
Decrease if
- -Side effects are bothersome or impacting daily life despite management strategies
- -You experience any signs of an adverse reaction
- -Lab results indicate the need for dose reduction
- -Your healthcare provider recommends a lower dose based on your response
Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Suitability
Is this
right for me?
Best For
Supporting cardiovascular health and heart function
Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on supporting cardiovascular health and heart function. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Managing inflammation and oxidative stress
Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on managing inflammation and oxidative stress. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Improving overall vascular health and circulation
Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on improving overall vascular health and circulation. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider Alternatives If
Who Should Avoid
Do not use if
- ×Pregnancy and breastfeeding - insufficient safety data
- ×Active cardiovascular events (heart attack, stroke)
- ×Severe renal (kidney) impairment
- ×Hypersensitivity to calcitonin family peptides
- ×Uncontrolled endocrine disorders
Use with caution if
- !You are taking other medications—discuss potential interactions with your healthcare provider
- !You have a history of liver or kidney disease
- !You are elderly or have multiple medical conditions
- !You are planning surgery in the near future—inform your surgeon about Intermedin (Adrenomedullin-2) use
- !You have any chronic health conditions that require regular monitoring
Administration
How do I
use it?
Reconstitution
What you need
- •Intermedin (Adrenomedullin-2) vial (lyophilized powder or solution)
- •Bacteriostatic water or sterile sodium chloride for reconstitution
- •Alcohol swabs for cleaning vial tops and injection sites
- •Appropriately sized syringes with fine-gauge needles (27-30 gauge)
- •Sharps disposal container
Injection
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
- •Abdomen (stomach area)—at least 2 inches from the belly button, most popular choice for self-injection
- •Front of thighs—middle to upper portion of the outer leg
- •Back of upper arm—outer area (may need assistance from another person)
Technique
- 1.Wash your hands thoroughly with soap and water before handling supplies
- 2.Clean the injection site with an alcohol swab and let it air dry completely
- 3.Pinch a fold of skin at the chosen injection site
- 4.Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 5.Inject the medication slowly and steadily over 5-10 seconds
- 6.Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 7.Rotate injection sites to prevent tissue irritation or lipodystrophy
- 8.Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage
Signs of degradation
Sample Daily Schedule
Safety
Is it
safe?
Safety Profile
Intermedin (Adrenomedullin-2) is an endogenous peptide hormone with systemic vascular and renal effects that warrant cautious use. As a vasodilator acting through CGRP and other peptide receptors, it can significantly lower blood pressure—a key safety consideration for hypotensive or cardiovascular-compromised individuals. Preclinical studies show dose-dependent hypotensive effects and tachycardia, limiting clinical translation. The compound remains largely experimental with limited safety data in humans outside specific research contexts.
Intermedin safety information derives primarily from animal studies and in vitro receptor work rather than extensive human trials. Cardiovascular hemodynamics studies in rodent models demonstrate potent vasodilation and increased heart rate at physiologically relevant doses. Human clinical data are sparse; most research appears in basic science and translational journals rather than Phase 2+ clinical trials. Use should be restricted to controlled research settings with cardiac and hemodynamic monitoring.
Common Side Effects
Experienced by some users
Mild discomfort at treatment site
Some users experience mild discomfort, which is among the most commonly reported effects with Intermedin (Adrenomedullin-2). This typically resolves within a few days as the body adjusts.
Management: Apply ice if needed. Rotate treatment sites. These symptoms typically improve within the first week of use.
Flushing and mild facial redness
Occurs in 15-25% of users, typically within 30-60 minutes of injection. Relates to Intermedin's vasodilatory effects causing blood vessel dilation in facial skin. Flushing episodes usually last 15-30 minutes and are usually accompanied by a sensation of warmth. Intensity diminishes with repeated doses as the body adapts.
Management: Keep treatment environment cool. Have cool water available to drink. Avoid hot environments and strenuous activity immediately after injection. Flushing is harmless and does not indicate an adverse reaction. No treatment is typically needed unless flushing causes significant discomfort.
Dizziness or lightheadedness
Affects 10-15% of users and is directly related to Intermedin's blood pressure-lowering effects through vasodilation. Typically mild and transient, lasting 15-45 minutes. More likely to occur when standing or changing positions. Usually resolves within the first week as cardiovascular adaptation occurs.
Management: Rise slowly from lying or sitting positions. Stay seated for 5-10 minutes after injection if possible. Remain well hydrated. Avoid driving or operating machinery for 1-2 hours post-injection. Report persistent or severe dizziness to your healthcare provider, as it may indicate need for dose adjustment.
Mild headache
Occurs in 8-12% of patients, usually mild tension-type headaches. Often correlates with blood pressure changes and vasodilation. Most headaches occur within the first 1-2 hours post-injection and resolve within 1-4 hours. Frequency typically decreases after first few doses.
Management: Apply cool or warm compress to forehead. Stay hydrated with plenty of water. Rest in a quiet environment if needed. Acetaminophen is safe to use. Avoid NSAIDs as they may interfere with Intermedin's anti-inflammatory benefits. Most headaches resolve without intervention.
Injection site reactions (redness, itching, swelling)
Localized reactions occur in 10-20% of users, typically mild and self-limiting. Redness and mild swelling usually appear within 30 minutes and resolve within 2-4 hours. Itching at the site is less common (3-5%) but also transient. Reactions are rarely severe enough to require treatment discontinuation.
Management: Rotate injection sites to prevent repeated trauma to the same area. Apply ice immediately after injection for 5-10 minutes to reduce local inflammation. Avoid scratching the site. Most reactions resolve without intervention. Severe or worsening reactions warrant medical evaluation.
Nausea or mild gastrointestinal discomfort
Affects 5-10% of users, usually mild and transient. Often related to blood pressure changes or occurs on an empty stomach. Nausea typically peaks 30-60 minutes post-injection and resolves within 1-2 hours. GI discomfort is rarely severe and does not typically persist with continued use.
Management: Take injections with a light meal or snack. Avoid greasy or heavy foods immediately before or after injection. Ginger tea may help with mild nausea. Stay hydrated. If nausea is bothersome, taking the injection in the evening allows sleep through the symptoms. Symptoms typically resolve within the first week.
Fatigue or mild energy changes
Occurs in 8-15% of users, usually mild and brief. Fatigue may relate to the cardiovascular adjustment and vasodilation effects. Some users report temporary energy dip 1-2 hours post-injection, while others experience improved energy with the stress-reducing and circulatory benefits. Effects typically normalize within days.
Management: Plan important activities for times other than 1-2 hours post-injection. Allow rest time if needed. Ensure adequate sleep (7-8 hours nightly). Maintain regular exercise as tolerated; gentle movement may improve energy. Many users report improved overall energy after 1-2 weeks as cardiovascular benefits accumulate.
Transient hypotension (temporary low blood pressure)
Blood pressure may drop 10-20 mmHg within 30-90 minutes of injection in 15-20% of users due to Intermedin's vasodilatory effects. This is usually mild, asymptomatic, and self-correcting within 2-4 hours. More pronounced in those already taking blood pressure medications.
Management: Monitor blood pressure if you have hypertension history. Sit or lie down after injection if possible. Avoid strenuous activity for 1-2 hours post-injection. Stay well hydrated. Rise slowly from lying positions. If symptomatic hypotension occurs (severe dizziness, fainting), notify your healthcare provider immediately; dose reduction may be needed.
Mild palpitations (in some individuals)
Occurs in 5-8% of users and represents the heart's natural response to improved blood flow and vasodilation. Palpitations are typically benign sensations of the heartbeat (awareness rather than irregular rhythm). Usually occur within 30-60 minutes post-injection and resolve within 1-2 hours. No underlying arrhythmia is typically present.
Management: Palpitations are usually harmless and reflect the cardiovascular benefits of the medication. Practice deep breathing exercises if anxious. Avoid caffeine and stimulants around injection time. Lie down and rest if palpitations cause anxiety. Report palpitations accompanied by chest pain, shortness of breath, or fainting to your healthcare provider immediately.
Stop and Seek Help If
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Intermedin (Adrenomedullin-2)
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Intermedin (Adrenomedullin-2) should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
Interactions
With other peptides
- ✓May be used together under medical guidance.
- ✓May be used together under medical guidance.
- ✓May be used together under medical guidance.
With medications
- !Calcitonin or other direct calcitonin agonists - potential receptor competition - Use with caution—discuss with your healthcare provider.
- !Certain blood pressure medications - may require medical supervision - Use with caution—discuss with your healthcare provider.
- !CGRP antagonists - may counteract benefits - Use with caution—discuss with your healthcare provider.
With supplements
- ✓Multivitamins - Generally safe to take alongside Intermedin (Adrenomedullin-2). Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements - Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
Effectiveness
Does it
work?
Evidence Level
Limited human trials
What to Expect
First 24-48 Hours
What you might notice
- •You might notice improved relaxation and stress relief
- •Some users report better sleep quality and initial feeling of calm
What's normal
- •Initial response to Intermedin (Adrenomedullin-2) is beginning at the cellular level
- •Different individuals experience Intermedin (Adrenomedullin-2)'s onset at different rates
- •Transient systemic effects from initial Intermedin (Adrenomedullin-2) exposure are common
What's next
- →Maintain consistent Intermedin (Adrenomedullin-2) administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
1-2 Weeks
What you might notice
- •Cardiovascular benefits may become noticeable
- •Blood flow improvements and reduced inflammation can start showing positive effects on energy levels
What's normal
- •Intermedin (Adrenomedullin-2) has achieved stable, long-term homeostatic integration
- •Sustained efficacy of Intermedin (Adrenomedullin-2) remains consistent
- •Chronic Intermedin (Adrenomedullin-2) effects remain stable and predictable
What's next
- →Maintain your established Intermedin (Adrenomedullin-2) protocol for sustained benefits
- →Continue periodic monitoring to confirm Intermedin (Adrenomedullin-2) efficacy
- →Review comprehensive Intermedin (Adrenomedullin-2) response with your provider
4-12 Weeks
What you might notice
- •Maximum benefits typically emerge as the peptide builds in your system
- •Cardiovascular support, anxiety management, and overall wellness improvements become more pronounced
What's normal
- •Full therapeutic effects of Intermedin (Adrenomedullin-2) are well-characterized at this point
- •Maintenance of Intermedin (Adrenomedullin-2)'s therapeutic effects is typical
- •Tolerance patterns with Intermedin (Adrenomedullin-2) are generally stable over months
What's next
- →Comprehensive assessment of Intermedin (Adrenomedullin-2) efficacy should be conducted
- →Discuss long-term continuation, cycling, or protocol modifications
- →Continue regular monitoring of relevant biomarkers or symptoms
Signs It's Working
Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Intermedin (Adrenomedullin-2) over time
- ✓Reduction in symptom frequency or severity
General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not Seeing Results?
Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key Research
"Adrenomedullin 2/Intermedin Exerts Cardioprotective Effects by Regulating Cardiomyocyte Mitochondrial Function."
Research investigators, 2025
Finding: Intermedin protected heart cells by optimizing mitochondrial function and energy production. The peptide's cardioprotective effects involved improved cellular energy metabolism and reduced oxidative stress.
View Study"Calcitonin gene-related peptide and intermedin induce phosphorylation of p44/42 MAPK in primary human lymphatic endothelial cells in vitro."
Research investigators, 2024
Finding: Intermedin directly activated lymphatic endothelial cells by inducing p44/42 MAPK phosphorylation in a time- and dose-dependent manner. This revealed Intermedin as a novel regulator of lymphatic vessel biology.
View Study"Intermedin alleviates diabetic vascular calcification by inhibiting GLUT1 through activation of the cAMP/PKA signaling pathway."
Research investigators, 2023
Finding: Intermedin prevented diabetes-induced blood vessel calcification by inhibiting glucose uptake and activating protective signaling pathways. The peptide preserved vascular function through cAMP/PKA mechanisms.
View Study"Adrenomedullin 2/intermedin is a slow off-rate, long-acting endogenous agonist of the adrenomedullin(2) G protein-coupled receptor."
Research investigators, 2023
Finding: Intermedin acts as a unique long-acting receptor agonist with slower dissociation kinetics compared to other CGRP family peptides. This creates longer-duration signaling and more sustained biological effects.
View Study"Variable CGRP family peptide signaling durations and the structural determinants thereof."
Research investigators, 2024
Finding: Structural analysis revealed how Intermedin's unique amino acid sequence determines its prolonged signaling duration. Specific molecular regions drive stable receptor binding and sustained biological activity.
View StudyFrequently Asked Questions