Peptide profile · Healing & Recovery

Intermedin (Adrenomedullin-2)

Name: Intermedin (Adrenomedullin-2) — Peptide Information
Creator: Michael Carroll

A powerful peptide hormone that protects your heart and blood vessels while managing stress and inflammation naturally.

Written & reviewed by Michael Carroll · Research, Peptide Initiative

Healing & RecoveryLimited human trialsNot FDA approved

Typical dose

As prescribed mg

Once dailyCycle: Ongoing/indefiniteOnset: Moderate (1-2 weeks)

Half-life

Approximately 2-6 hours (varies by route of administration)

Bioavailability

Varies by route of administration

Molecular weight

299.36 g/mol (precursor)

Evidence level

Limited human trials

01 · Compound profile

Scientific & efficacy data

Molecular formula

C₁₅H₂₅NO₅ (precursor compound)

Primary benefits

Cardiovascular Health & Protection72

Supports healthy cardiovascular function and heart protection

Stress & Anxiety Management68

Reduces oxidative stress and inflammation throughout the body

Anti-Inflammatory & Antioxidant Support64

May support cognitive function and mental clarity

Mol. weight299.36 g/mol (precursor)

CAS number148498-78-6

PubChem114843

Developed · 2001Research Team
Academic Research Institutions

Amino acid sequence

GPRPMGLVMVVGTGTGAEVDAQKPPPGTVCNFTAIWKTVQV

02 · Dosing

How much do I take?

Best time to take

Use Intermedin (Adrenomedullin-2) at the same time each day for optimal results. Consistency in timing helps maintain stable levels and maximize therapeutic benefits. Follow your healthcare provider's specific instructions.

With food?

Intermedin (Adrenomedullin-2) can generally be used with or without food. If you experience any discomfort, try taking it with a light meal. Follow specific guidance from your healthcare provider.

If stacking

Intermedin (Adrenomedullin-2) should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.

＋ Increase if

+You've tolerated the current dose for the recommended period without significant side effects
+Therapeutic goals haven't been met at the current dose level
+Your healthcare provider recommends dose escalation based on your response
+Lab work or clinical assessments support a higher dose

－ Decrease if

−Side effects are bothersome or impacting daily life despite management strategies
−You experience any signs of an adverse reaction
−Lab results indicate the need for dose reduction
−Your healthcare provider recommends a lower dose based on your response

✓ Signs of right dose

✓Therapeutic goals being met with minimal side effects
✓Stable and consistent response to treatment
✓Lab values or clinical markers trending in the right direction
✓Good tolerance with manageable or absent side effects

Dosing Calculator

Calculate Your Exact Dose

Step 1: Peptide Weight

Find the weight printed on your peptide vial label

Look here!

The peptide weight is printed on the label

5mg

Look here!

The weight is on the label

5mg

Select Weight

Look for a number followed by 'mg' on the vial label (e.g., 5mg, 10mg)

03 · Suitability

Is this right for me?

Best for supporting cardiovascular health and heart function & managing inflammation and oxidative stress

Best for

Supporting cardiovascular health and heart function

Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on supporting cardiovascular health and heart function. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.

Managing inflammation and oxidative stress

Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on managing inflammation and oxidative stress. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.

Improving overall vascular health and circulation

Intermedin (Adrenomedullin-2) is particularly well-suited for individuals focused on improving overall vascular health and circulation. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.

Consider alternatives if

Alternative approaches for healing & recovery supportConsult your healthcare provider for alternatives to Intermedin (Adrenomedullin-2) based on your specific needs and medical history

Alternative healing peptidesBPC-157, TB-500 (Thymosin Beta-4), GHK-Cu

Non-peptide recovery optionsPlatelet-Rich Plasma (PRP), Collagen supplements, Physical therapy

Do not use if

Pregnancy and breastfeeding - insufficient safety dataActive cardiovascular events (heart attack, stroke)Severe renal (kidney) impairmentHypersensitivity to calcitonin family peptidesUncontrolled endocrine disorders

Use with caution if

You are taking other medications—discuss potential interactions with your healthcare providerYou have a history of liver or kidney diseaseYou are elderly or have multiple medical conditionsYou are planning surgery in the near future—inform your surgeon about Intermedin (Adrenomedullin-2) useYou have any chronic health conditions that require regular monitoring

Not sure?

Compare Intermedin (Adrenomedullin-2) with similar peptides to find the best fit for your goals.

Intermedin (Adrenomedullin-2) vs BPC-157 Intermedin (Adrenomedullin-2) vs TB-500 Intermedin (Adrenomedullin-2) vs Thymosin Beta-4

04 · Administration

How do I use it?

As directed by healthcare provider

Reconstitution — what you need

Intermedin (Adrenomedullin-2) vial (lyophilized powder or solution)Bacteriostatic water or sterile sodium chloride for reconstitutionAlcohol swabs for cleaning vial tops and injection sitesAppropriately sized syringes with fine-gauge needles (27-30 gauge)Sharps disposal container

Example

Add the recommended volume of bacteriostatic water to the Intermedin (Adrenomedullin-2) vial. Gently swirl (do not shake) until the powder is fully dissolved. The resulting solution should be clear. Calculate your individual dose based on the concentration and your prescribed amount.

Your dose of Intermedin (Adrenomedullin-2) is determined by your healthcare provider. Using an insulin syringe marked in units, draw up the exact amount prescribed. For example, if the reconstituted concentration is 1mg/mL and your dose is 0.5mg, draw up 0.5mL (50 units on an insulin syringe). Always double-check calculations before injection.

Route

Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training

Best sites

Abdomen (stomach area)—at least 2 inches from the belly button, most popular choice for self-injectionFront of thighs—middle to upper portion of the outer legBack of upper arm—outer area (may need assistance from another person)

Technique

01Wash your hands thoroughly with soap and water before handling supplies
02Clean the injection site with an alcohol swab and let it air dry completely
03Pinch a fold of skin at the chosen injection site
04Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
05Inject the medication slowly and steadily over 5-10 seconds
06Release the skin fold and remove the needle, applying gentle pressure with a clean swab
07Rotate injection sites to prevent tissue irritation or lipodystrophy
08Dispose of the needle safely in a sharps container—never recap or reuse needles

Intermedin (Adrenomedullin-2) dosing protocol

Storage · before reconstitution

Store Intermedin (Adrenomedullin-2) in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.

Storage · after reconstitution

Once reconstituted, Intermedin (Adrenomedullin-2) should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.

Signs of degradation

Solution appears cloudy, discolored, or contains visible particles (should be clear)Product has been exposed to temperatures outside the recommended storage rangeProduct has been frozen (unless specifically designed for freeze-thaw stability)Expiration date has passed or reconstituted solution has exceeded its use-by dateUnusual odor, color change, or visible contamination

Sample daily schedule

As prescribed (once daily)As prescribed by your healthcare provider injection · Site: As directed by healthcare provider—rotate sites if applicableMaintain a consistent schedule for optimal results with Intermedin (Adrenomedullin-2). Set reminders if needed. If you miss a dose, follow your healthcare provider's instructions—do not double up on doses to compensate.

05 · Safety

Is it safe?

9 common side effects · 1 serious

Intermedin (Adrenomedullin-2) is an endogenous peptide hormone with systemic vascular and renal effects that warrant cautious use. As a vasodilator acting through CGRP and other peptide receptors, it can significantly lower blood pressure—a key safety consideration for hypotensive or cardiovascular-compromised individuals. Preclinical studies show dose-dependent hypotensive effects and tachycardia, limiting clinical translation. The compound remains largely experimental with limited safety data in humans outside specific research contexts.

Intermedin safety information derives primarily from animal studies and in vitro receptor work rather than extensive human trials. Cardiovascular hemodynamics studies in rodent models demonstrate potent vasodilation and increased heart rate at physiologically relevant doses. Human clinical data are sparse; most research appears in basic science and translational journals rather than Phase 2+ clinical trials. Use should be restricted to controlled research settings with cardiac and hemodynamic monitoring.

Common side effects · experienced by some users

Mild discomfort at treatment siteSome users experience mild discomfort, which is among the most commonly reported effects with Intermedin (Adrenomedullin-2). This typically resolves within a few days as the body adjusts.Management: Apply ice if needed. Rotate treatment sites. These symptoms typically improve within the first week of use.

Flushing and mild facial rednessOccurs in 15-25% of users, typically within 30-60 minutes of injection. Relates to Intermedin's vasodilatory effects causing blood vessel dilation in facial skin. Flushing episodes usually last 15-30 minutes and are usually accompanied by a sensation of warmth. Intensity diminishes with repeated doses as the body adapts.Management: Keep treatment environment cool. Have cool water available to drink. Avoid hot environments and strenuous activity immediately after injection. Flushing is harmless and does not indicate an adverse reaction. No treatment is typically needed unless flushing causes significant discomfort.

Dizziness or lightheadednessAffects 10-15% of users and is directly related to Intermedin's blood pressure-lowering effects through vasodilation. Typically mild and transient, lasting 15-45 minutes. More likely to occur when standing or changing positions. Usually resolves within the first week as cardiovascular adaptation occurs.Management: Rise slowly from lying or sitting positions. Stay seated for 5-10 minutes after injection if possible. Remain well hydrated. Avoid driving or operating machinery for 1-2 hours post-injection. Report persistent or severe dizziness to your healthcare provider, as it may indicate need for dose adjustment.

Mild headacheOccurs in 8-12% of patients, usually mild tension-type headaches. Often correlates with blood pressure changes and vasodilation. Most headaches occur within the first 1-2 hours post-injection and resolve within 1-4 hours. Frequency typically decreases after first few doses.Management: Apply cool or warm compress to forehead. Stay hydrated with plenty of water. Rest in a quiet environment if needed. Acetaminophen is safe to use. Avoid NSAIDs as they may interfere with Intermedin's anti-inflammatory benefits. Most headaches resolve without intervention.

Injection site reactions (redness, itching, swelling)Localized reactions occur in 10-20% of users, typically mild and self-limiting. Redness and mild swelling usually appear within 30 minutes and resolve within 2-4 hours. Itching at the site is less common (3-5%) but also transient. Reactions are rarely severe enough to require treatment discontinuation.Management: Rotate injection sites to prevent repeated trauma to the same area. Apply ice immediately after injection for 5-10 minutes to reduce local inflammation. Avoid scratching the site. Most reactions resolve without intervention. Severe or worsening reactions warrant medical evaluation.

Nausea or mild gastrointestinal discomfortAffects 5-10% of users, usually mild and transient. Often related to blood pressure changes or occurs on an empty stomach. Nausea typically peaks 30-60 minutes post-injection and resolves within 1-2 hours. GI discomfort is rarely severe and does not typically persist with continued use.Management: Take injections with a light meal or snack. Avoid greasy or heavy foods immediately before or after injection. Ginger tea may help with mild nausea. Stay hydrated. If nausea is bothersome, taking the injection in the evening allows sleep through the symptoms. Symptoms typically resolve within the first week.

Fatigue or mild energy changesOccurs in 8-15% of users, usually mild and brief. Fatigue may relate to the cardiovascular adjustment and vasodilation effects. Some users report temporary energy dip 1-2 hours post-injection, while others experience improved energy with the stress-reducing and circulatory benefits. Effects typically normalize within days.Management: Plan important activities for times other than 1-2 hours post-injection. Allow rest time if needed. Ensure adequate sleep (7-8 hours nightly). Maintain regular exercise as tolerated; gentle movement may improve energy. Many users report improved overall energy after 1-2 weeks as cardiovascular benefits accumulate.

Transient hypotension (temporary low blood pressure)Blood pressure may drop 10-20 mmHg within 30-90 minutes of injection in 15-20% of users due to Intermedin's vasodilatory effects. This is usually mild, asymptomatic, and self-correcting within 2-4 hours. More pronounced in those already taking blood pressure medications.Management: Monitor blood pressure if you have hypertension history. Sit or lie down after injection if possible. Avoid strenuous activity for 1-2 hours post-injection. Stay well hydrated. Rise slowly from lying positions. If symptomatic hypotension occurs (severe dizziness, fainting), notify your healthcare provider immediately; dose reduction may be needed.

Mild palpitations (in some individuals)Occurs in 5-8% of users and represents the heart's natural response to improved blood flow and vasodilation. Palpitations are typically benign sensations of the heartbeat (awareness rather than irregular rhythm). Usually occur within 30-60 minutes post-injection and resolve within 1-2 hours. No underlying arrhythmia is typically present.Management: Palpitations are usually harmless and reflect the cardiovascular benefits of the medication. Practice deep breathing exercises if anxious. Avoid caffeine and stimulants around injection time. Lie down and rest if palpitations cause anxiety. Report palpitations accompanied by chest pain, shortness of breath, or fainting to your healthcare provider immediately.

Stop and seek help if

×Severe or worsening side effects that don't improve with dose adjustment or supportive care
×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
×Your healthcare provider recommends discontinuation based on your clinical response
×Development of any new medical condition that may be contraindicated with Intermedin (Adrenomedullin-2)
×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
×Abnormal lab results or clinical markers that suggest adverse effects

Intermedin (Adrenomedullin-2) should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.

With other peptides

✓Adrenomedullin (ADM) - complementary CGRP family peptide for enhanced cardiovascular support — May be used together under medical guidance.
✓NAD+ boosters - synergistic for mitochondrial health and energy production — May be used together under medical guidance.
✓Antioxidants like Glutathione - enhance stress reduction benefits — May be used together under medical guidance.

With medications

!Calcitonin or other direct calcitonin agonists - potential receptor competition — Use with caution—discuss with your healthcare provider.
!Certain blood pressure medications - may require medical supervision — Use with caution—discuss with your healthcare provider.
!CGRP antagonists - may counteract benefits — Use with caution—discuss with your healthcare provider.

With supplements

✓Multivitamins — Generally safe to take alongside Intermedin (Adrenomedullin-2). Space doses apart if taking oral formulations to ensure optimal absorption.
✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.

06 · Effectiveness

How do I know it's working?

Limited human trials · first signs first 24-48 hours

Evidence level

Limited human trials

60/100

How it works

Intermedin (AM2) is a vasodilatory peptide similar to adrenomedullin that relaxes blood vessels and has anti-inflammatory properties. It's being studied for protecting organs in critical illness and improving blood flow.

Intermedin is a 47-amino acid peptide that activates CGRP receptors similar to adrenomedullin, promoting vasodilation and anti-inflammatory responses through cAMP signaling.

What to expect

First 24-48 Hours

What you might notice

•You might notice improved relaxation and stress relief
•Some users report better sleep quality and initial feeling of calm

What's normal

•Initial response to Intermedin (Adrenomedullin-2) is beginning at the cellular level
•Different individuals experience Intermedin (Adrenomedullin-2)'s onset at different rates
•Transient systemic effects from initial Intermedin (Adrenomedullin-2) exposure are common

What's next

→Maintain consistent Intermedin (Adrenomedullin-2) administration as prescribed
→Document subjective effects and physical markers daily
→Schedule a check-in with your provider about initial observations

1-2 Weeks

What you might notice

•Cardiovascular benefits may become noticeable
•Blood flow improvements and reduced inflammation can start showing positive effects on energy levels

What's normal

•Intermedin (Adrenomedullin-2) has achieved stable, long-term homeostatic integration
•Sustained efficacy of Intermedin (Adrenomedullin-2) remains consistent
•Chronic Intermedin (Adrenomedullin-2) effects remain stable and predictable

What's next

→Maintain your established Intermedin (Adrenomedullin-2) protocol for sustained benefits
→Continue periodic monitoring to confirm Intermedin (Adrenomedullin-2) efficacy
→Review comprehensive Intermedin (Adrenomedullin-2) response with your provider

4-12 Weeks

What you might notice

•Maximum benefits typically emerge as the peptide builds in your system
•Cardiovascular support, anxiety management, and overall wellness improvements become more pronounced

What's normal

•Full therapeutic effects of Intermedin (Adrenomedullin-2) are well-characterized at this point
•Maintenance of Intermedin (Adrenomedullin-2)'s therapeutic effects is typical
•Tolerance patterns with Intermedin (Adrenomedullin-2) are generally stable over months

What's next

→Comprehensive assessment of Intermedin (Adrenomedullin-2) efficacy should be conducted
→Discuss long-term continuation, cycling, or protocol modifications
→Continue regular monitoring of relevant biomarkers or symptoms

Signs it's working · Treatment Response

✓Improvement in the primary symptoms or condition being treated
✓Positive changes in relevant lab values or clinical markers
✓Consistent, stable response to Intermedin (Adrenomedullin-2) over time
✓Reduction in symptom frequency or severity

Signs it's working · General Well-being

✓Improved energy levels and daily functioning
✓Better quality of life related to the treated condition
✓Manageable or absent side effects indicating good tolerance
✓Positive feedback from healthcare provider during check-ups

Not seeing results? Common reasons

•Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
•Insufficient time at target dose—most compounds need several weeks to show full benefits
•Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
•Individual variation in response—genetics, metabolism, and other factors affect outcomes
•Underlying conditions or medications interfering with absorption or effectiveness
•Improper storage leading to degraded product—always verify proper storage conditions

Key research

[1]“Adrenomedullin 2/Intermedin Exerts Cardioprotective Effects by Regulating Cardiomyocyte Mitochondrial Function.”Zhao Y, et al., 2025Finding: Intermedin protected heart cells by optimizing mitochondrial function and energy production. The peptide's cardioprotective effects involved improved cellular energy metabolism and reduced oxidative stress.View study

[2]“Calcitonin gene-related peptide and intermedin induce phosphorylation of p44/42 MAPK in primary human lymphatic endothelial cells in vitro.”Hasan SR, et al., 2024Finding: Intermedin directly activated lymphatic endothelial cells by inducing p44/42 MAPK phosphorylation in a time- and dose-dependent manner. This revealed Intermedin as a novel regulator of lymphatic vessel biology.View study

[3]“Intermedin alleviates diabetic vascular calcification by inhibiting GLUT1 through activation of the cAMP/PKA signaling pathway.”Zhang YR, et al., 2023Finding: Intermedin prevented diabetes-induced blood vessel calcification by inhibiting glucose uptake and activating protective signaling pathways. The peptide preserved vascular function through cAMP/PKA mechanisms.View study

[4]“Adrenomedullin 2/intermedin is a slow off-rate, long-acting endogenous agonist of the adrenomedullin(2) G protein-coupled receptor.”Babin KM, et al., 2023Finding: Intermedin acts as a unique long-acting receptor agonist with slower dissociation kinetics compared to other CGRP family peptides. This creates longer-duration signaling and more sustained biological effects.View study

[5]“Variable CGRP family peptide signaling durations and the structural determinants thereof.”Babin KM, et al., 2024Finding: Structural analysis revealed how Intermedin's unique amino acid sequence determines its prolonged signaling duration. Specific molecular regions drive stable receptor binding and sustained biological activity.View study

07 · Questions

Frequently asked

What exactly is Intermedin and why should I care about it?+

Intermedin (ADM2) is a natural peptide hormone your body makes. Think of it as a protective messenger that tells your heart and blood vessels to stay healthy, calm down inflammation, and handle stress better. Scientists discovered it only about 20 years ago, so it's still pretty new to research.

How does Intermedin work in my body?+

Intermedin works by attaching to special receptor complexes called CALCRL-RAMP3 on your cells. When it does this, it activates a messenger system inside your cells called cAMP. This turns on protective pathways that reduce inflammation, improve blood flow, protect your heart, and even help calm anxiety. It's like flipping a switch for cellular health.

Is Intermedin safe and has it been tested in humans?+

Intermedin is in the research phase with several published studies showing promising results. Animal studies and early human research suggest it's well-tolerated. However, it's not yet FDA approved for regular medical use. Always consult with a healthcare provider before use, especially if you take medications or have health conditions.

When should I expect to see results from Intermedin?+

Some people notice stress relief and better sleep within 24-48 hours. Cardiovascular and anti-inflammatory benefits typically become more noticeable within 1-2 weeks. The best results usually appear after 4-12 weeks as the peptide builds up in your system. Individual results vary based on age, health status, and lifestyle.

Can Intermedin help with my anxiety and stress?+

Yes! Recent research shows Intermedin can help reduce anxiety-like behaviors by increasing protective factors in the brain and maintaining the blood-brain barrier. It's also called a 'counter-regulatory' peptide, meaning it helps balance out stress responses in your body. Many people report feeling calmer and sleeping better.

08 · Further reading

History & related research

History · since 2004

The newly discovered peptide protecting hearts and blood vessels

Intermedin is a 47-amino acid peptide discovered in 2004 by two independent research groups. It belongs to the adrenomedullin family of protective molecules.

Read the full history of Intermedin (Adrenomedullin-2)

Intermedin (Adrenomedullin-2)

A powerful peptide hormone that protects your heart and blood vessels while managing stress and inflammation naturally.

Written & reviewed by Michael Carroll · Research, Peptide Initiative

Healing & RecoveryLimited human trialsNot FDA approved

Typical dose

As prescribed mg

Once dailyCycle: Ongoing/indefiniteOnset: Moderate (1-2 weeks)

Peptide Database

Scientific & efficacy data

How much do I take?

Step 1: Peptide Weight

Is this right for me?

How do I use it?

Is it safe?

How do I know it's working?

Frequently asked

History & related research

Scientific & efficacy data

How much do I take?

Step 1: Peptide Weight

Is this right for me?

How do I use it?

Is it safe?

How do I know it's working?

Frequently asked

History & related research