Peptide profile · Metabolic
Xenin-25
The Natural Incretin Helper Peptide That Enhances Glucose Control and Insulin Response
Written by Michael Carroll — Owner, Director of Research · Reviewed by the Peptide Initiative Research Team
Typical dose
4 pmol/kg/min (after a brief higher loading ramp of 10.8→7.7→5.6 pmol/kg/min over the first 10 min)
Half-life
10-15 minutes (IV administration, subject to variation)
Bioavailability
IV: ~100%; Subcutaneous: Research-dependent; Oral: Limited due to peptide nature (active research)
Molecular weight
2971.6 g/mol
Evidence level
Moderate human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
C139H224N38O32S
Primary benefits
Xenin-25 directly enhances insulin secretion in response to glucose, making it one of the most targeted metabolic peptides for natural glucose regulation
Works in harmony with other incretin hormones to create a coordinated response system for managing blood sugar levels
A naturally occurring hormone produced by your own intestinal cells, meaning your body recognizes and responds to it with established biological pathways
Academic Research Institutions
Amino acid sequence
SLLLASDPYMGCNYAVTCDLYNNLPLPRPPHRLAVYGQSARRRVK02 · Dosing
How much do I take?
4 pmol/kg/min (after a brief higher loading ramp of 10.8→7.7→5.6 pmol/kg/min over the first 10 min) · continuous infusion
Intravenous infusion: Delivered straight into a vein through a drip (IV), done by a clinician.
Bioavailability Complete (about 100%) — delivered straight into the bloodstream.
Best time to take
Xenin-25 is administered intravenously in a clinical setting. Timing is determined by your healthcare provider based on the treatment protocol and your medical needs.
With food?
IV administration of Xenin-25 is not dependent on meal timing. Your healthcare team will provide specific instructions regarding food and fluid intake around treatment sessions.
If stacking
Xenin-25 should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
+ Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
- Decrease if
- −Side effects are bothersome or impacting daily life despite management strategies
- −You experience any signs of an adverse reaction
- −Lab results indicate the need for dose reduction
- −Your healthcare provider recommends a lower dose based on your response
✓ Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Select Weight
Look for a number followed by 'mg' on the vial label (e.g., 5mg, 10mg)
03 · Suitability
Is this right for me?
Best for supporting healthy glucose metabolism & enhancing insulin response efficiency
Best for
Supporting healthy glucose metabolism
Xenin-25 is particularly well-suited for individuals focused on supporting healthy glucose metabolism. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Enhancing insulin response efficiency
Xenin-25 is particularly well-suited for individuals focused on enhancing insulin response efficiency. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Research into metabolic disorder treatment
Xenin-25 is particularly well-suited for individuals focused on research into metabolic disorder treatment. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Xenin-25 with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Intravenous (IV) · Subcutaneous (SC)
Reconstitution — what you need
Example
Add the recommended volume of bacteriostatic water to the Xenin-25 vial. Gently swirl (do not shake) until the powder is fully dissolved. The resulting solution should be clear. Calculate your individual dose based on the concentration and your prescribed amount.
Your dose of Xenin-25 is determined by your healthcare provider. Using an insulin syringe marked in units, draw up the exact amount prescribed. For example, if the reconstituted concentration is 1mg/mL and your dose is 0.5mg, draw up 0.5mL (50 units on an insulin syringe). Always double-check calculations before injection.
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
Technique
- 01Wash your hands thoroughly with soap and water before handling supplies
- 02Clean the injection site with an alcohol swab and let it air dry completely
- 03Pinch a fold of skin at the chosen injection site
- 04Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 05Inject the medication slowly and steadily over 5-10 seconds
- 06Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 07Rotate injection sites to prevent tissue irritation or lipodystrophy
- 08Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage · before reconstitution
Store Xenin-25 in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.
Storage · after reconstitution
Once reconstituted, Xenin-25 should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.
Signs of degradation
Sample daily schedule
05 · Safety
Is it safe?
3 common side effects · 2 serious
Xenin-25 is a 25-amino acid natural gut peptide discovered in 1992 with moderate evidence from Phase 1-2 human clinical trials. The peptide has been extensively studied in metabolic research for over 30 years. Safety profile shows good tolerability in research settings with mild, transient gastrointestinal effects being the most common. Critical limitation: Xenin-25 has NOT completed Phase 3 clinical trials and is not FDA-approved for clinical use. No serious adverse effects have been reported in research studies, but hypoglycemia risk requires careful monitoring when combined with insulin or other glucose-lowering agents. Individual responses to Xenin-25 are generally mild gastrointestinal discomfort, nausea, or headache in the first few days—these typically resolve with continued use. The peptide's glucose-dependent mechanism makes hypoglycemia unlikely when used alone, but additive effects with other agents require medical supervision.
Xenin-25's evidence base spans over 30 years of investigation since its 1992 discovery as a neurotensin-related gut peptide. Phase 1-2 clinical data demonstrates its role as a glucose-dependent insulin secretagogue with additive effects when combined with GIP. Human tolerability studies show a favorable safety profile at therapeutic doses, though the peptide is rapidly degraded by DPP-IV, limiting its clinical utility without stabilization modifications.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Xenin-25
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Xenin-25 should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- ✓GIP (Glucose-dependent Insulinotropic Polypeptide) — Both secreted from same K-cells; show synergistic glucose control benefits when combined
- ✓GLP-1 — Complementary incretin hormone mechanisms enhance overall glucose homeostasis
- ✓Sitagliptin — DPP-IV inhibitors preserve xenin activity and enhance combined metabolic effects
With medications
- !Insulin (without professional medical monitoring) — Risk of hypoglycemia without proper glucose monitoring and dose adjustment
With supplements
- ✓Multivitamins — Generally safe to take alongside Xenin-25. Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
06 · Effectiveness
How do I know it's working?
Moderate human trials · first signs immediate (0-1 hours) (onset of action)
Evidence level
Moderate human trials
(Phase 1-2)
How it works
Xenin-25 is a stomach peptide that regulates digestion and nutrient absorption. It works with other digestive hormones to control stomach contractions and secretions, and is being studied for gastroparesis (slow stomach emptying).
Xenin-25 is a 25-amino acid peptide derived from neurotensin-like sequences that activates GLP-1 receptors and neurotensin receptors, promoting gastric motility and modulating glucose homeostasis.
What to expect
Immediate (0-1 hours) (Onset of action)
What you might notice
- •After injection or oral intake, xenin begins binding to receptors almost immediately
- •You may notice nothing obvious, but your body is preparing glucose regulatory responses
What's normal
- •Initial response to Xenin-25 is beginning at the cellular level
- •Different individuals experience Xenin-25's onset at different rates
- •Transient systemic effects from initial Xenin-25 exposure are common
What's next
- →Maintain consistent Xenin-25 administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
Acute Response (1-4 hours) (Peak effects)
What you might notice
- •Peak insulin secretion response occurs around 30-60 minutes post-administration when combined with glucose intake
- •Maximum glucose control benefits are evident during this window
What's normal
- •Xenin-25 is achieving sufficient receptor engagement
- •Initial mechanism of Xenin-25 is taking effect
- •Early transient effects from Xenin-25 administration are resolving
What's next
- →Maintain consistent Xenin-25 administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
Short-term (Hours to Days) (Adjustment phase)
What you might notice
- •Your body adjusts to the improved glucose regulation
- •Some mild side effects (nausea, fatigue) may appear but typically resolve
- •Glucose stability improves noticeably
What's normal
- •Xenin-25 is achieving sufficient receptor engagement
- •Initial mechanism of Xenin-25 is taking effect
- •Early transient effects from Xenin-25 administration are resolving
What's next
- →Maintain consistent Xenin-25 administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
Ongoing (Weeks of Regular Use) (Established benefit phase)
What you might notice
- •With consistent use, the synergistic benefits with endogenous GIP and other hormones become more pronounced
- •Improved insulin sensitivity and more stable glucose patterns throughout the day
What's normal
- •Full therapeutic effects of Xenin-25 are well-characterized at this point
- •Maintenance of Xenin-25's therapeutic effects is typical
- •Tolerance patterns with Xenin-25 are generally stable over months
What's next
- →Comprehensive assessment of Xenin-25 efficacy should be conducted
- →Discuss long-term continuation, cycling, or protocol modifications
- →Continue regular monitoring of relevant biomarkers or symptoms
Signs it's working · Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Xenin-25 over time
- ✓Reduction in symptom frequency or severity
Signs it's working · General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key research
08 · Questions
Frequently asked
What makes Xenin-25 different from GLP-1?+
While GLP-1 and Xenin-25 are both incretin hormones, they work through different signaling pathways. Xenin appears to have stronger synergistic effects with GIP and may offer complementary benefits. GLP-1 is already approved by the FDA, while Xenin-25 is still in research stages.
Can I use Xenin-25 without medical supervision?+
No. Xenin-25 is a research compound, not an FDA-approved medication. It should only be used under medical supervision in clinical trial settings or approved research protocols. Using any peptide without professional medical guidance carries significant risks.
How does Xenin-25 work with food?+
Xenin-25 is glucose-dependent, meaning its insulin-stimulating effects are strongest when blood sugar is elevated from food intake. It works best when taken in conjunction with meals containing carbohydrates. This makes it a smart hormone that responds to actual metabolic needs.
Is Xenin-25 natural?+
Yes and no. Your body naturally produces xenin as a hormone from K-cells in your small intestine. However, xenin used in research is synthesized in laboratories. It's not a natural extraction, but it's identical to the hormone your body makes.
What are the storage requirements?+
Xenin-25 should be stored at 2-8°C (36-46°F) in the original container, protected from light. Do not freeze. Once reconstituted, use immediately for optimal stability. Always check specific storage instructions from your supplier.
Can Xenin-25 cause hypoglycemia?+
Xenin-25 itself typically doesn't cause hypoglycemia because it's glucose-dependent—it only stimulates insulin when blood sugar is elevated. However, if combined with insulin or other glucose-lowering medications without proper medical coordination, hypoglycemia risk increases. Medical supervision is essential when combining therapies.
How long has Xenin-25 been studied?+
Xenin was discovered in 1992 and has been studied for over 30 years. Multiple clinical trials have evaluated its effects on insulin secretion, glucose tolerance, and metabolic function. It's one of the more thoroughly researched emerging peptide hormones.
09 · Further reading
History & related research
History · since 1992
The appetite control peptide that helps manage blood sugar
Xenin-25 is a 25-amino acid peptide made naturally in your stomach and intestines. It helps control hunger, manage insulin, and regulate digestion.
Read the full history of Xenin-25