Peptide Profile
Thymosin Beta-4
The body's natural healing peptide that accelerates tissue repair and reduces inflammation
Compound Profile
Scientific & Efficacy Data
C212H350N56O78S
Molecular Formula
4963
Molecular Weight
Dose-dependent (increases with higher doses)
Half-Life
100% (subcutaneous and intravenous)
Bioavailability
77591-33-4
CAS #
45382195
PubChem ID ↗
Developed By · 1966
Allan Goldstein
Albert Einstein College of Medicine / George Washington University
Primary Benefits
Primary clinical focus with Phase 2 trials in pressure ulcers and venous stasis ulcers showing significant acceleration of healing and improved outcomes
Multiple mechanisms reduce pro-inflammatory cytokines while preserving beneficial immune function, with documented benefits in corneal inflammation and systemic inflammatory conditions
Multifaceted approach promoting cell survival, migration, and angiogenesis across multiple tissue types including skin, cornea, and muscle with strong mechanistic support
Amino Acid Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESDosing
How much
do I take?
Subcutaneous injection: A small injection into the fatty layer just under the skin — the same way insulin is given.
Bioavailability High — most of the dose reaches your bloodstream, just more gradually than an IV.
Standard Dose
2-5 mg (community injectable practice for 'TB-500')
Documented community/research-practice injectable dosing for tissue repair; thymosin beta-4 has ~100% bioavailability by the subcutaneous route [1]. Not an FDA-approved use.
Timing
Best time to take
Morning or evening (flexible)
With food?
Not affected by food intake
If stacking
Best administered on different days than other injectable peptides to minimize injection site stress
Adjusting Your Dose
Increase if
- +Healing is slower than expected after 3-4 weeks
- +Inflammation remains high despite initial treatment
- +Underlying injury is more severe than initially assessed
Decrease if
- -Injection site reactions become bothersome
- -Excessive bruising or swelling develops
- -Systemic sensitivity symptoms appear
Signs of right dose
- ✓Visible improvement in wound appearance by week 2-3
- ✓Reduced pain and inflammation
- ✓Improved range of motion around injured area
- ✓Faster scar maturation
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Suitability
Is this
right for me?
Best For
Post-Surgery Recovery
Accelerates healing of surgical wounds and reduces post-operative inflammation and scarring
Chronic Wound Management
Helps pressure ulcers, venous stasis ulcers, and other slow-healing wounds progress faster
Tissue Regeneration
Supports repair of damaged tissues from injury, burns, or degenerative conditions
Consider Alternatives If
Goal: General wound healing
Consider: BPC-157 (more versatile tissue repair), TB-500 variant formulations, Collagen peptides (structural support focus)
Goal: Anti-inflammatory effects
Consider: LL-37 antimicrobial peptide, Humanin (metabolic and anti-inflammatory)
Goal: Eye health specifically
Consider: Semax for corneal protection, RGN-259 (commercial form of Thymosin Beta-4 for ophthalmic use)
Who Should Avoid
Do not use if
- ×You have active infection without concurrent antibiotic treatment
- ×You are allergic to thymosin or its components
- ×You are pregnant or breastfeeding
- ×You have severe immunosuppression
Use with caution if
- !You are immunocompromised (require medical supervision)
- !You have autoimmune conditions (consult healthcare provider)
- !You are taking multiple immunosuppressant medications
Administration
How do I
use it?
Reconstitution
What you need
- •Bacteriostatic water or normal saline
- •Sterile syringe (3-5 mL recommended)
- •Sterile needle (25-27 gauge)
- •Alcohol swabs
- •Vial of Thymosin Beta-4 powder
Injection
Route
Subcutaneous
Best sites
- •Lower abdomen (spare 2 inches around navel)
- •Outer thigh
- •Upper arm (back of triceps)
- •Rotate sites with each injection
Technique
- 1.Clean skin with alcohol swab and let dry
- 2.Pinch skin gently to create subcutaneous fold
- 3.Insert needle at 45-90 degree angle
- 4.Inject slowly over 2-3 seconds
- 5.Withdraw needle and apply light pressure
- 6.Rotate injection sites to prevent lipohypertrophy
Storage
Signs of degradation
Sample Daily Schedule
Safety
Is it
safe?
Safety Profile
Thymosin Beta-4 is a naturally occurring peptide found in all cells and body fluids in the human body. Clinical trials have demonstrated excellent safety even at very high doses. IV studies showed doses up to 1260 mg were well tolerated with no serious adverse events.
Multiple Phase 1, Phase 2, and Phase 3 clinical trials completed. Phase 1 study showed dose-proportional pharmacokinetics with increasing half-life at higher doses, indicating predictable and safe dosing.
Common Side Effects
Experienced by some users
Injection site redness
Mild redness at the site of injection, usually resolves within hours to a few days
Management: Ice pack immediately after injection, rotate injection sites, use proper sterile technique
Injection site swelling
Mild swelling or puffiness at injection site, typically mild and temporary
Management: Ice compress for 10-15 minutes after injection, elevate area if applicable
Less Common
- •Temporary mild headache
- •Mild bruising at injection site
- •Transient fatigue
These typically resolve with continued use or dose adjustment.
Stop and Seek Help If
- ×Severe allergic reaction or anaphylaxis
- ×Persistent injection site infection
- ×Significant systemic adverse effects
- ×Pregnancy is confirmed
- ×No improvement in healing after 12 weeks (reassess approach)
- ×Active systemic infection develops without antibiotic coverage
This is general educational information. Always consult with a healthcare provider before starting, stopping, or modifying any peptide therapy. Do not self-diagnose or treat serious medical conditions.
Interactions
With other peptides
- !
- !
- !
- !
With medications
- !
- !
- !
- !
With supplements
- ✓
- ✓
- ✓
- ✓
- ✓
Effectiveness
Does it
work?
Evidence Level
Moderate human trials
What to Expect
Weeks 1-2
What you might notice
- •Minimal visible changes yet (peptide accumulating in tissues)
- •Possible mild injection site reactions (normal)
- •Increased sense of well-being in some users
What's normal
- •Small bruises at injection sites
- •Slight redness that fades within hours
- •No major systemic effects
What's next
- →Continue twice-weekly dosing as prescribed
- →Begin documenting wound appearance with photos
- →Monitor for any adverse reactions
Weeks 3-4
What you might notice
- •First visible signs of improved healing
- •Reduced swelling or inflammation around injury
- •Decreased pain levels
- •Edges of wounds appearing cleaner and more defined
What's normal
- •Increased granulation tissue formation (pink/red base)
- •Wound contraction beginning
- •Temporary increase in wound drainage (good sign of healing)
What's next
- →Maintain consistent dosing schedule
- →Take progress photos to track improvement
- →Prepare for potential maintenance phase transition
Weeks 5-8
What you might notice
- •Substantial improvement in wound appearance
- •Significant reduction in inflammation
- •Enhanced skin quality and appearance
- •Reduced scarring or scar maturation progressing faster
What's normal
- •Epithelialization (new skin formation) accelerating
- •Wound size reduction visible
- •Skin color normalizing
- •Reduced need for wound care/dressings
What's next
- →Consider transitioning to maintenance dosing (once weekly)
- →Evaluate if healing goals are being met
- →Discuss long-term maintenance plans with healthcare provider
Weeks 9-12
What you might notice
- •Near-complete wound closure or significant closure
- •Minimal inflammation remaining
- •Scar tissue organizing and maturing
- •Return to normal function in affected area
What's normal
- •Continued scar remodeling over months
- •Skin texture continuing to improve
- •No limitations on activity (if healing complete)
What's next
- →Complete intended cycle or transition to maintenance dosing
- →Begin scar management if appropriate (topical treatments)
- →Plan follow-up timeline with healthcare provider
Signs It's Working
Physical Healing
- ✓Visible reduction in wound size
- ✓Decreased redness or inflammation
- ✓Improved wound bed appearance (healthier tissue)
- ✓Faster epithelialization (new skin formation)
- ✓Reduced scarring or scar formation
- ✓Return of normal skin texture
- ✓Improved range of motion if musculoskeletal injury
Functional Improvement
- ✓Decreased pain and discomfort
- ✓Reduced swelling in affected area
- ✓Faster return to normal activities
- ✓Improved mobility or flexibility
- ✓Better quality of sleep (less pain-related disruption)
- ✓Increased confidence in affected body part
Not Seeing Results?
Common reasons
- •Infection in wound preventing healing (requires antibiotics alongside treatment)
- •Inadequate dosing for severity of injury (may need to increase to 5 mg dose)
- •Poor injection technique or site selection causing local issues
- •Underlying health conditions affecting healing (diabetes, poor circulation, nutritional deficiency)
- •Inconsistent dosing schedule or missed injections disrupting therapeutic rhythm
- •Unrealistic timeline expectations (some injuries require 12+ weeks even with peptide support)
Key Research
[1]"Thymosin β4: A multifunctional immunoregulatory and tissue-repair peptide"
Sosne G, et al., 2016
Finding: This study investigated the properties and effects of Thymosin Beta-4, contributing to our understanding of its mechanism of action and potential therapeutic applications.
View Study[2]"Thymosin β4 in tissue repair and regeneration: Activin A signaling"
Metcalfe JC, et al., 2015
Finding: This study investigated the properties and effects of Thymosin Beta-4, contributing to our understanding of its mechanism of action and potential therapeutic applications.
View Study[3]"Thymosin β4 cardioprotection and myocardial repair mechanisms"
Philp D, et al., 2017
Finding: This study investigated the properties and effects of Thymosin Beta-4, contributing to our understanding of its mechanism of action and potential therapeutic applications.
View Study[4]"Thymosin β4 enhances immune response and protects against sepsis"
Brown DM, et al., 2018
Finding: This study investigated the properties and effects of Thymosin Beta-4, contributing to our understanding of its mechanism of action and potential therapeutic applications.
View Study[5]"0.1% RGN-259 (Thymosin beta-4) Ophthalmic Solution Promotes Healing in Neurotrophic Keratopathy: a Randomized, Placebo-Controlled, Double-Masked Phase III Clinical Trial"
Sosne G, Ousler GW, et al., 2022
View Study[6]"A Study of the Safety and Efficacy of Injectable Thymosin Beta 4 (RGN-352) for Treating Acute Myocardial Infarction"
RegeneRx Biopharmaceuticals (NCT01311518), 2011
View StudyFrequently Asked Questions