Peptide profile · Weight Management
Exenatide
First-in-class GLP-1 receptor agonist derived from Gila monster venom (Byetta/Bydureon), FDA-approved for type 2 diabetes with demonstrated cardiovascular safety in the 14,752-patient EXSCEL trial and available in both twice-daily and once-weekly formulations
Written & reviewed by Michael Carroll · Research, Peptide Initiative
Typical dose
10 mcg
Half-life
Byetta: ~2.4 hours (immediate-release); Bydureon: ~7 weeks effective duration via PLGA microsphere technology; Tmax ~2.1 hours (Byetta)
Bioavailability
65–75% after subcutaneous injection (Byetta); microsphere sustained release for Bydureon
Molecular weight
4,187 Da
Evidence level
Strong human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
C184H282N50O60S
Primary benefits
Works like a key that unlocks your body's natural insulin release, but only when blood sugar is high, which helps prevent dangerous lows.
Slows down digestion and sends fullness signals to your brain, helping most people lose around 5 to 11 pounds over time.
A major study of nearly 15,000 people showed it doesn't increase heart attack or stroke risk, even in those with heart disease.
AstraZeneca (originally Amylin Pharmaceuticals)
Amino acid sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS02 · Dosing
How much do I take?
10 mcg · twice daily, within 60 minutes before the two main meals
Subcutaneous: A small injection into the fatty layer just under the skin — the same way insulin is given.
Bioavailability High — most of the dose reaches your bloodstream, just more gradually than an IV.
Best time to take
Administer Exenatide at the same time each day (or on the same day each week for weekly injections). Many users prefer morning or evening administration. Pick a time you'll remember consistently.
With food?
Exenatide injections can be given regardless of meal timing. However, if GI effects occur, administering on an empty stomach or with a light meal may help reduce discomfort.
If stacking
Exenatide should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
＋ Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
－ Decrease if
- −Side effects are bothersome or impacting daily life despite management strategies
- −You experience any signs of an adverse reaction
- −Lab results indicate the need for dose reduction
- −Your healthcare provider recommends a lower dose based on your response
✓ Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Select Weight
Look for a number followed by 'mg' on the vial label (e.g., 5mg, 10mg)
03 · Suitability
Is this right for me?
Best for type 2 diabetes patients inadequately controlled on metformin seeking add-on therapy with weight loss benefit & patients preferring once-weekly dosing convenience (bydureon 2 mg) over daily injections for improved adherence
Best for
Type 2 diabetes patients inadequately controlled on metformin seeking add-on therapy with weight loss benefit
Exenatide is particularly well-suited for individuals focused on type 2 diabetes patients inadequately controlled on metformin seeking add-on therapy with weight loss benefit. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Patients preferring once-weekly dosing convenience (Bydureon 2 mg) over daily injections for improved adherence
Exenatide is particularly well-suited for individuals focused on patients preferring once-weekly dosing convenience (bydureon 2 mg) over daily injections for improved adherence. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Overweight or obese type 2 diabetes patients (BMI >27) requiring glycemic control without weight gain
Exenatide is particularly well-suited for individuals focused on overweight or obese type 2 diabetes patients (bmi >27) requiring glycemic control without weight gain. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Patients with established cardiovascular disease who need a GLP-1 RA with demonstrated cardiovascular safety
Exenatide is particularly well-suited for individuals focused on patients with established cardiovascular disease who need a glp-1 ra with demonstrated cardiovascular safety. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Exenatide with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Subcutaneous injection
Reconstitution — what you need
Example
Add the recommended volume of bacteriostatic water to the Exenatide vial. Gently swirl (do not shake) until the powder is fully dissolved. The resulting solution should be clear. Calculate your individual dose based on the concentration and your prescribed amount.
Your dose of Exenatide is determined by your healthcare provider. Using an insulin syringe marked in units, draw up the exact amount prescribed. For example, if the reconstituted concentration is 1mg/mL and your dose is 0.5mg, draw up 0.5mL (50 units on an insulin syringe). Always double-check calculations before injection.
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
Technique
- 01Wash your hands thoroughly with soap and water before handling supplies
- 02Clean the injection site with an alcohol swab and let it air dry completely
- 03Pinch a fold of skin at the chosen injection site
- 04Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 05Inject the medication slowly and steadily over 5-10 seconds
- 06Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 07Rotate injection sites to prevent tissue irritation or lipodystrophy
- 08Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage · before reconstitution
Store Exenatide in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.
Storage · after reconstitution
Once reconstituted, Exenatide should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.
Signs of degradation
Sample daily schedule
05 · Safety
Is it safe?
4 common side effects · 2 serious
Exenatide is an FDA-approved GLP-1 receptor agonist with post-market safety data spanning 15+ years, though some safety concerns have emerged. Nausea affects 30-45% of patients, dose-dependent and typically improves within 1-2 weeks but can lead to treatment discontinuation in 5% of patients. Pancreatitis risk, while rare (0.1-0.2%), is increased and contraindicated in patients with history of acute pancreatitis. Benign thyroid C-cell adenomas were seen in rats across all exenatide doses in a 104-week carcinogenicity study, but this appears only in the Nonclinical Toxicology section: the immediate-release label (Byetta) carries no boxed warning and does not contraindicate medullary thyroid cancer or MEN 2. That contraindication belonged to extended-release Bydureon, which no longer has a current US label. Acute kidney injury has been reported in 0.3-1% of patients, particularly with concurrent NSAID or ACE inhibitor use. Hypoglycemia risk is minimal when used as monotherapy but increases substantially when combined with insulin or sulfonylureas.
Exenatide was studied in Phase 3 trials (DURATION program) for type 2 diabetes with long-term safety data spanning 5-10 years in individual trials. Multiple post-market surveillance studies and comparative efficacy trials with other GLP-1 agonists (particularly semaglutide) provide evidence of its safety profile. The preclinical thyroid C-cell findings and post-market pancreatitis reports have led to specific monitoring recommendations and contraindication protocols.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Exenatide
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Exenatide should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- ✓Metformin (first-line combination with additive glycemic benefit — extensively studied in AMIGO and DURATION trials) — May be used together under medical guidance.
- ✓SGLT2 inhibitors such as empagliflozin or dapagliflozin (complementary weight loss and cardiovascular mechanisms) — May be used together under medical guidance.
- ✓Basal insulin (glargine or degludec) — once-weekly exenatide plus daily basal insulin is a convenient, effective combination with careful hypoglycemia monitoring — May be used together under medical guidance.
With medications
- !Other GLP-1 receptor agonists (liraglutide, semaglutide, dulaglutide) — redundant mechanism with increased adverse effects — Use with caution—discuss with your healthcare provider.
- !DPP-4 inhibitors (sitagliptin, saxagliptin) — overlapping incretin pathway; no additional benefit over exenatide alone — Use with caution—discuss with your healthcare provider.
- !Sulfonylureas at full dose — increased hypoglycemia risk; reduce sulfonylurea dose when initiating exenatide — Use with caution—discuss with your healthcare provider.
With supplements
- ✓Multivitamins — Generally safe to take alongside Exenatide. Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
06 · Effectiveness
How do I know it's working?
Strong human trials · first signs weeks 1-4 (initiation and titration)
Evidence level
Strong human trials
(Phase 3 or FDA approved)
How it works
Exenatide (Byetta/Bydureon) is a first-in-class GLP-1 hormone derived from Gila monster venom that helps control blood sugar and reduces weight by increasing insulin release, suppressing glucagon, and promoting satiety—available as both twice-daily and once-weekly injections.
Exenatide is a 39-amino acid synthetic peptide identical to exendin-4, a naturally occurring GLP-1 receptor agonist from Gila monster (Heloderma suspectum) venom. With 53% amino acid homology to human GLP-1 but a critical Gly2 substitution (vs Ala2 in native GLP-1), exenatide resists DPP-4 enzymatic degradation, conferring a 2.4-hour half-life (Byetta) or ~7 weeks via poly(D,L-lactide-co-glycolide) microsphere formulation (Bydureon). Exenatide binds to and activates the GLP-1 receptor (Kd ~136 pM, ~4-fold higher affinity than native GLP-1) on pancreatic beta cells to stimulate glucose-dependent insulin secretion, suppresses postprandial glucagon, delays gastric emptying, and promotes satiety through hypothalamic GLP-1 receptor activation.
What to expect
Weeks 1-4 (initiation and titration)
What you might notice
- •Reduced appetite and early feelings of fullness, especially after meals
- •Nausea that may be prominent during the first 1–2 weeks (up to 44% with Byetta)
- •Initial improvements in postprandial blood glucose readings
- •Modest early weight loss (0.5–1 kg) from reduced caloric intake
What's normal
- •GI side effects are most common during this phase — this is the primary reason for gradual titration
- •Glycemic improvements begin but may be modest at the 5 mcg starting dose
- •For Bydureon, a small subcutaneous nodule at the injection site is expected (microsphere depot)
- •Blood glucose monitoring should be more frequent during this adjustment period
What's next
- →Increase Byetta from 5 to 10 mcg after 1 month if well tolerated
- →For Bydureon, steady state drug levels build over 4–8 weeks — be patient with initial response
- →GI side effects should begin improving by week 2–3
Weeks 4-16 (dose optimization)
What you might notice
- •More significant HbA1c improvement as maintenance dose takes full effect
- •Progressive weight loss (1–3 kg total by 12–16 weeks)
- •Significant improvement or resolution of initial GI side effects
- •Improved postprandial blood glucose control throughout the day
What's normal
- •Bydureon reaches full steady state by week 6–8, so maximum efficacy develops gradually
- •Weight loss continues steadily with maintained appetite suppression
- •HbA1c should show measurable improvement (0.5–1.0% reduction) by 12 weeks
- •Injection site nodules with Bydureon are benign and gradually resolve
What's next
- →Evaluate overall glycemic and weight response at 16 weeks
- →If additional glycemic control needed, consider adding basal insulin or SGLT2 inhibitor
- →Continue current therapy if goals are being met
Months 4-12+ (long-term maintenance)
What you might notice
- •Sustained glycemic control with HbA1c reduction of 0.8–1.5% from baseline
- •Stable weight loss of 2–5 kg maintained over months to years
- •Well-tolerated therapy with minimal ongoing side effects
- •DURATION studies show efficacy maintained through 5+ years of continuous use
What's normal
- •Weight loss rate naturally plateaus after initial months — this is expected metabolic adaptation
- •Glycemic benefits remain stable with continued therapy
- •Cardiovascular safety established through EXSCEL for long-term use
- •Periodic monitoring of HbA1c, renal function, and lipids recommended
What's next
- →Continue long-term therapy with periodic metabolic assessment
- →If glycemic targets not met, consider intensifying with insulin or switching to higher-efficacy GLP-1 RA
- →Annual comprehensive metabolic and cardiovascular risk assessment
Signs it's working · Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Exenatide over time
- ✓Reduction in symptom frequency or severity
Signs it's working · General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key research
07 · Questions
Frequently asked
How was exenatide discovered from Gila monster venom?+
Dr. John Eng, an endocrinologist at the Miami VA Medical Center, discovered exendin-4 in Gila monster (Heloderma suspectum) venom in 1992 while studying how this lizard maintains glucose homeostasis during prolonged fasting between infrequent meals. Exendin-4 turned out to be a potent GLP-1 receptor agonist naturally resistant to the DPP-4 enzyme that rapidly degrades human GLP-1, making it an ideal drug candidate for type 2 diabetes.
What is the difference between Byetta and Bydureon?+
Both contain exenatide but differ in formulation and dosing. Byetta is immediate-release exenatide (5–10 mcg injected twice daily before meals) that provides acute prandial glucose control. Bydureon uses poly(D,L-lactide-co-glycolide) microsphere technology to deliver 2 mg exenatide once weekly, providing sustained GLP-1 receptor activation with lower nausea rates and improved patient adherence.
What did the EXSCEL cardiovascular trial show?+
EXSCEL enrolled 14,752 type 2 diabetes patients (73% with prior cardiovascular disease) across 688 sites in 35 countries. After a median 3.2 years of follow-up, once-weekly exenatide was noninferior to placebo for cardiovascular safety (MACE HR 0.91, 95% CI 0.83–1.00). While it met the safety endpoint, it did not demonstrate statistically significant cardiovascular superiority (P=0.06 for superiority).
Can exenatide be used in children?+
Yes, Bydureon BCise was approved in 2020 for pediatric patients aged 10–17 years with type 2 diabetes as an adjunct to diet and exercise. This makes exenatide one of the few GLP-1 receptor agonists with an approved pediatric indication.
How does exenatide compare to newer GLP-1 receptor agonists?+
Exenatide was the first GLP-1 RA and has the longest safety track record. However, newer agents like semaglutide offer greater HbA1c reduction and weight loss. Meta-analyses show semaglutide > dulaglutide > exenatide for overall efficacy. Exenatide's advantages include its established safety record, two formulation options (BID and weekly), and the pediatric indication for Bydureon BCise.
Why does exenatide cause more nausea than some other GLP-1 agonists?+
Byetta (immediate-release) causes more nausea (~44%) because it produces rapid, high peak plasma concentrations that strongly activate GLP-1 receptors in the area postrema (nausea center). Bydureon (extended-release) has lower nausea rates (25–30%) because the microsphere formulation provides gradual, sustained release without sharp peaks. Newer long-acting GLP-1 RAs also tend to have lower nausea rates for similar reasons.
08 · Further reading
History & related research
History · since 1992
The Lizard Venom That Launched a Diabetes Revolution
A poisonous desert lizard, a stubborn scientist in a Bronx VA hospital, and a government that refused to patent the discovery — this is the unlikely story of how Gila monster spit became one of the most important diabetes drugs ever made.
Read the full history of ExenatideStudied for