Peptide profile · Immune
Defensin (HBD-3)
Most potent human beta-defensin (45 amino acids) with unique salt-insensitive antimicrobial activity — kills MRSA at MIC 0.5-1.0 μg/mL regardless of salt concentration, disrupts biofilms at 4-8 μg/mL, and retains full bactericidal function even without its disulfide bonds — representing a next-generation antimicrobial peptide template for combating antibiotic resistance
Written by Michael Carroll — Owner, Director of Research · Reviewed by the Peptide Initiative Research Team
Typical dose
200 µg/mL applied to the wound, about 4 µg per dose (20 µL)
Half-life
Short systemic half-life (minutes) typical of cationic peptides; disulfide-bonded form provides protease resistance at local tissue sites; linear form shows adequate stability for topical applications
Bioavailability
Topical application achieves high local concentrations; maintains activity in physiological salt environments (unique); linear form retains activity enabling simplified formulation; not intended for oral or systemic delivery
Molecular weight
~5,155 Da (mature peptide)
Evidence level
Moderate human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
Approximately C220H340N64O62S6 (45-amino acid peptide with 3 disulfide bonds)
Primary benefits
This peptide kills dangerous superbugs like MRSA that don't respond to regular antibiotics, working at very low doses where other treatments fail.
It breaks through the protective slime layer that bacteria build in chronic wounds, helping clear infections that won't go away with standard care.
It calls in your body's infection-fighting cells to the problem area while also calming down inflammation that could damage healthy tissue.
Microbiotix Inc.
Amino acid sequence
GIINTLQKYYCRVRGGRCSTPSDVVIACPGSMYDPTANTVTYDYPD02 · Dosing
How much do I take?
200 µg/mL applied to the wound, about 4 µg per dose (20 µL) · every 2 days in the study
Topical: Applied onto the skin as a cream, gel, or lotion — it works mainly where you put it.
Bioavailability Local — acts mainly at the skin; little reaches the bloodstream.
Best time to take
Apply Defensin (HBD-3) to clean, dry skin. For best results, use consistently at the same time(s) each day. Evening application is often preferred to allow overnight absorption, unless otherwise directed.
With food?
As a topical product, Defensin (HBD-3) is not affected by food intake. Apply to clean skin and allow adequate absorption time before covering the area.
If stacking
Defensin (HBD-3) should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
+ Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
- Decrease if
- −Side effects are bothersome or impacting daily life despite management strategies
- −You experience any signs of an adverse reaction
- −Lab results indicate the need for dose reduction
- −Your healthcare provider recommends a lower dose based on your response
✓ Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Select Weight
Look for a number followed by 'mg' on the vial label (e.g., 5mg, 10mg)
03 · Suitability
Is this right for me?
Best for research into anti-mrsa therapeutics and alternatives to vancomycin for resistant infections & development of antimicrobial wound dressings and medical device coatings
Best for
Research into anti-MRSA therapeutics and alternatives to vancomycin for resistant infections
Defensin (HBD-3) is particularly well-suited for individuals focused on research into anti-mrsa therapeutics and alternatives to vancomycin for resistant infections. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Development of antimicrobial wound dressings and medical device coatings
Defensin (HBD-3) is particularly well-suited for individuals focused on development of antimicrobial wound dressings and medical device coatings. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Anti-biofilm strategies for chronic wound infections and implant-associated infections
Defensin (HBD-3) is particularly well-suited for individuals focused on anti-biofilm strategies for chronic wound infections and implant-associated infections. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Applications requiring antimicrobial activity in physiological or high-salt environments
Defensin (HBD-3) is particularly well-suited for individuals focused on applications requiring antimicrobial activity in physiological or high-salt environments. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Defensin (HBD-3) with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Topical application (research/wound care) · Local injection (preclinical research)
Reconstitution — what you need
Example
Defensin (HBD-3) comes in pre-measured doses or forms. Follow the exact dosing instructions on your prescription label. No reconstitution or mixing is typically required for this formulation.
Use Defensin (HBD-3) exactly as prescribed. Each unit contains the labeled amount. Your healthcare provider will determine the appropriate dose based on your individual needs and response.
Route
Defensin (HBD-3) is administered Topical application (research/wound care)—no injection required
Best sites
Technique
- 01Follow the specific administration instructions for your Defensin (HBD-3) formulation
- 02Take or apply as directed by your healthcare provider
- 03Store properly between uses according to package instructions
Storage · before reconstitution
Store Defensin (HBD-3) in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.
Storage · after reconstitution
Once reconstituted, Defensin (HBD-3) should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.
Signs of degradation
Sample daily schedule
05 · Safety
Is it safe?
3 common side effects · 2 serious
Defensin HBD-3 is not FDA-approved and has no completed human clinical trials, existing only in research contexts with in vitro and animal study data. Animal toxicology studies demonstrate no major systemic toxicity at doses exceeding therapeutic levels, but human immunological responses to exogenously administered defensin peptides have not been characterized. Risks include potential immune activation, cross-reactivity with self-antigens (due to HBD-3 expression in healthy epithelial cells), development of anti-peptide antibodies, and possible tolerance development with repeated dosing. Bacterial and fungal resistance to defensin-based therapy is theoretically possible. No human pharmacokinetics, dose-ranging studies, Phase 1 safety assessments, or clinical efficacy data exist.
Evidence is limited to in vitro studies of antimicrobial activity, animal infection models demonstrating efficacy, and immunological studies using isolated cells. No human safety data, pharmacokinetics, or clinical trials of any phase have been conducted. Published research focuses exclusively on mechanism and animal proof-of-concept rather than safety characterization.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Defensin (HBD-3)
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Defensin (HBD-3) should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- ✓HBD-2 (Human Beta-Defensin 2) — complementary: HBD-3 provides potent salt-insensitive killing while HBD-2 provides stronger CCR6-mediated dendritic cell recruitment for adaptive immune activation — May be used together under medical guidance.
- ✓LL-37 (Cathelicidin) — synergistic broad-spectrum antimicrobial coverage through complementary membrane disruption mechanisms; LL-37 adds LPS neutralization — May be used together under medical guidance.
- ✓Conventional antibiotics (vancomycin, oxacillin) — HBD-3 disrupts biofilms allowing antibiotic penetration, overcoming the primary resistance mechanism of biofilm-associated MRSA — May be used together under medical guidance.
With medications
- !Anionic polymers or surfactants — may complex with the cationic HBD-3 and neutralize activity through electrostatic interactions — Use with caution—discuss with your healthcare provider.
- !High concentrations of divalent cations (Ca²⁺, Mg²⁺) in formulation — may affect peptide-membrane interactions at extreme concentrations — Use with caution—discuss with your healthcare provider.
- !Proteolytic wound debridement enzymes (collagenase) applied simultaneously — may degrade the peptide at the application site despite its relative protease resistance — Use with caution—discuss with your healthcare provider.
With supplements
- ✓Multivitamins — Generally safe to take alongside Defensin (HBD-3). Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
06 · Effectiveness
How do I know it's working?
Moderate human trials · first signs minutes to hours (acute phase)
Evidence level
Moderate human trials
(Phase 1-2)
How it works
Human beta-defensin-3 (HBD-3) is a potent antimicrobial peptide that your immune system produces to kill a wide range of pathogens and also helps regulate inflammation and promote immune cell recruitment.
HBD-3 is a 45-amino acid cationic antimicrobial peptide with multiple disulfide bonds creating a stable 3D structure resistant to proteolytic degradation. Its high cationic charge density (from multiple arginine and lysine residues) enables strong electrostatic interactions with bacterial and fungal membranes, causing rapid membrane depolarization and microbial cell death. HBD-3 also modulates innate immunity through CC chemokine receptor signaling and TLR4 activation, promoting recruitment and activation of dendritic cells and macrophages while suppressing systemic inflammatory responses through pattern recognition receptor engagement.
What to expect
Minutes to hours (acute phase)
What you might notice
- •Rapid bactericidal activity — MRSA killing begins within minutes of contact at MIC concentrations
- •Biofilm disruption initiating at higher concentrations (4-8 μg/mL)
- •Mild local warmth or redness from monocyte recruitment via CCR2
- •Immediate antimicrobial effect regardless of wound fluid salt concentration
What's normal
- •HBD-3 acts rapidly — one of the fastest-acting human antimicrobial peptides
- •Activity is maintained in wound fluid, serum, or high-salt environments (unique advantage)
- •Biofilm disruption may release bacterial debris causing temporary increase in wound exudate
What's next
- →Continue application per research protocol
- →Monitor bacterial clearance through culture or molecular assays
- →Document any local tissue responses for safety assessment
Days 1-7 (research protocol)
What you might notice
- •Significant reduction in MRSA and other target pathogen burden at treatment site
- •Visible biofilm disruption and clearance in chronic wound models
- •Improved wound bed quality with healthier granulation tissue
- •Enhanced monocyte/macrophage infiltration supporting tissue repair
What's normal
- •Continued pathogen clearance with daily application
- •Wound appearance may temporarily worsen as biofilms are disrupted before improving
- •Local immune cell recruitment intensifies during the first week of treatment
What's next
- →Assess treatment efficacy through bacterial quantification and wound measurements
- →Consider combination with conventional antibiotics to exploit biofilm-disrupted bacteria
- →Adjust concentration based on observed response and pathogen sensitivity
Week 2-4 (extended research protocol)
What you might notice
- •Near-complete or complete eradication of target pathogens including resistant strains
- •Advanced wound healing with re-epithelialization in wound models
- •Resolution of chronic infection signs (odor, excessive exudate, poor granulation)
- •Stable wound bed without evidence of recurrent bacterial colonization
What's normal
- •HBD-3's multi-mechanism approach (killing + biofilm disruption + immune recruitment) provides comprehensive infection resolution
- •The salt-insensitive activity ensures consistent performance throughout the treatment course
- •Newly healed tissue should show healthy vascularization and epithelial coverage
What's next
- →Complete research protocol endpoints
- →Document efficacy data for potential clinical translation
- →Assess durability of antimicrobial effect after treatment cessation
Signs it's working · Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Defensin (HBD-3) over time
- ✓Reduction in symptom frequency or severity
Signs it's working · General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key research
08 · Questions
Frequently asked
What makes HBD-3 the most potent human beta-defensin?+
HBD-3 has three extraordinary properties that set it apart: (1) It carries a +11 net charge at physiological pH — the highest among human beta-defensins — which drives powerful electrostatic attraction to bacterial membranes. (2) This high charge density makes it salt-insensitive, retaining full antimicrobial activity at 150 mM NaCl where HBD-1 and HBD-2 lose function. (3) Its antimicrobial mechanism doesn't require the canonical three disulfide bonds — even linearized (reduced) HBD-3 kills bacteria effectively. These combined properties produce MIC values of 0.5-1.0 μg/mL against MRSA, making it 50-100x more potent than HBD-2.
Why is salt-insensitivity important for antimicrobial peptides?+
Most antimicrobial peptides, including HBD-1 and HBD-2, rely on electrostatic attraction to bacterial membranes. Physiological salt concentrations (150 mM NaCl) shield these charges, dramatically reducing antimicrobial activity. This means many defensins lose their killing power in real biological environments like wound fluid, blood, and airway surface liquid. HBD-3's salt-insensitivity means it functions effectively in the actual body environments where infections occur — a critical advantage for therapeutic development.
How does HBD-3 fight antibiotic-resistant biofilms?+
Bacterial biofilms are communities of bacteria encased in a protective extracellular matrix that makes them 100-1000x more resistant to conventional antibiotics. HBD-3 disrupts these biofilms at concentrations of 4-8 μg/mL against MRSA biofilms through its high cationic charge, which disrupts the anionic components of the biofilm matrix. Once the biofilm is disrupted, the released bacteria are susceptible to killing by both HBD-3 and conventional antibiotics — making HBD-3 an ideal partner for combination therapy with drugs that cannot penetrate biofilms alone.
Why don't bacteria easily develop resistance to HBD-3?+
HBD-3 kills bacteria through physical disruption of their cell membranes, which is fundamentally different from conventional antibiotics that target specific molecular pathways. For bacteria to become resistant, they would need to fundamentally alter their membrane lipid composition — a change so extreme it would likely compromise membrane function and viability. While some bacteria have evolved partial resistance mechanisms (surface charge modifications, protease secretion), the barrier to full resistance is far higher than for conventional antibiotics.
What does it mean that HBD-3 works without disulfide bonds?+
Most beta-defensins require their three disulfide bonds for proper folding and antimicrobial function. The discovery that HBD-3 retains full bactericidal activity even when these bonds are reduced (creating a linear peptide) was a surprising finding published in 2005 by Wu and colleagues. This means HBD-3's antimicrobial mechanism relies primarily on its high charge density rather than its 3D structure. Practically, this simplifies peptide synthesis for therapeutic development — linear peptides are much cheaper and easier to manufacture than disulfide-bonded ones.
How does HBD-3 compare to LL-37 for wound healing applications?+
Both are promising antimicrobial peptides for wound care, but with different strengths. LL-37 has advanced further clinically (Phase I/IIa and IIb trials completed), has stronger wound healing promotion through angiogenesis (FPRL1-mediated), and neutralizes endotoxin. HBD-3 is more potent against MRSA (0.5-1.0 vs ~10 μg/mL), more effective at disrupting biofilms, and has salt-insensitive activity. For chronic wounds colonized with antibiotic-resistant biofilm-forming bacteria, HBD-3 may be the superior antimicrobial agent, while LL-37 may be better for promoting wound closure. Combining both could provide optimal broad-spectrum antimicrobial and pro-healing coverage.
09 · Further reading
History & related research
History · since 2001
The Swiss Army knife of immune defense—a tiny soldier that attacks both types of dangerous bacteria.
HBD-3 is a small antimicrobial peptide discovered in 2001 that acts like a tiny warrior in your body. It kills both gram-positive and gram-negative bacteria, which is unique and powerful.
Read the full history of Defensin (HBD-3)