Peptide Profile
Adrenomedullin
A powerful vasodilatory peptide that relaxes blood vessels and helps your body maintain healthy fluid balance and blood pressure.
Dose Range
As prescribed-As prescribedmg
Frequency
Once daily
Route
Intravenous infusion
Cycle Length
Ongoing/indefinite
Onset
Moderate (1-2 weeks)
Evidence
Moderate
Compound Profile
Scientific & Efficacy Data
C264H406N80O77S3
Molecular Formula
6029 Da (Daltons)
Molecular Weight
Approximately 20-30 minutes in plasma (rapid metabolism)
Half-Life
Parenteral administration only; peptide undergoes proteolytic cleavage in circulation
Bioavailability
148498-78-6
CAS #
56841671
PubChem ID ↗
Developed By · 1993
Research Team
Academic Research Institutions
Primary Benefits
Supports healthy blood pressure regulation through natural vasodilation
Helps maintain kidney function and natural fluid balance
Supports the body's inflammatory response and immune function
Amino Acid Sequence
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2Dosing
How much
do I take?
Timing
Best time to take
Adrenomedullin is administered intravenously in a clinical setting. Timing is determined by your healthcare provider based on the treatment protocol and your medical needs.
With food?
IV administration of Adrenomedullin is not dependent on meal timing. Your healthcare team will provide specific instructions regarding food and fluid intake around treatment sessions.
If stacking
Adrenomedullin should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
Adjusting Your Dose
Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
Decrease if
- -Side effects are bothersome or impacting daily life despite management strategies
- -You experience any signs of an adverse reaction
- -Lab results indicate the need for dose reduction
- -Your healthcare provider recommends a lower dose based on your response
Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Suitability
Is this
right for me?
Best For
Cardiovascular health optimization
Adrenomedullin is particularly well-suited for individuals focused on cardiovascular health optimization. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Maintaining healthy blood pressure
Adrenomedullin is particularly well-suited for individuals focused on maintaining healthy blood pressure. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Recovery from illness or sepsis
Adrenomedullin is particularly well-suited for individuals focused on recovery from illness or sepsis. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Tissue protection and oxygen delivery
Adrenomedullin is particularly well-suited for individuals focused on tissue protection and oxygen delivery. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider Alternatives If
Who Should Avoid
Do not use if
- ×Severe hypotension or shock states
- ×Concurrent use with certain vasopressor medications
- ×Pregnancy and breastfeeding
- ×Severe kidney or liver dysfunction
Use with caution if
- !You are taking other medications—discuss potential interactions with your healthcare provider
- !You have a history of liver or kidney disease
- !You are elderly or have multiple medical conditions
- !You are planning surgery in the near future—inform your surgeon about Adrenomedullin use
- !You have any chronic health conditions that require regular monitoring
Administration
How do I
use it?
Reconstitution
What you need
- •Adrenomedullin vial (lyophilized powder or solution)
- •Bacteriostatic water or sterile sodium chloride for reconstitution
- •Alcohol swabs for cleaning vial tops and injection sites
- •Appropriately sized syringes with fine-gauge needles (27-30 gauge)
- •Sharps disposal container
Injection
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
- •Abdomen (stomach area)—at least 2 inches from the belly button, most popular choice for self-injection
- •Front of thighs—middle to upper portion of the outer leg
- •Back of upper arm—outer area (may need assistance from another person)
Technique
- 1.Wash your hands thoroughly with soap and water before handling supplies
- 2.Clean the injection site with an alcohol swab and let it air dry completely
- 3.Pinch a fold of skin at the chosen injection site
- 4.Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 5.Inject the medication slowly and steadily over 5-10 seconds
- 6.Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 7.Rotate injection sites to prevent tissue irritation or lipodystrophy
- 8.Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage
Signs of degradation
Sample Daily Schedule
Safety
Is it
safe?
Safety Profile
Adrenomedullin safety in humans is poorly characterized, with clinical data limited to observational studies and small uncontrolled trials in cardiovascular patients. Animal studies demonstrate potent vasodilatory effects that could lower blood pressure dangerously, particularly in patients on antihypertensive medications. No human pharmacokinetic studies have established safe doses, and potential for hypotension, electrolyte disturbances, and off-target vasodilation effects exists. The peptide crosses the blood-brain barrier and affects central nervous system function in animal models, raising concerns about neurological effects at higher doses.
Evidence is limited to animal studies, in vitro mechanistic research, and a small number of uncontrolled clinical observations in patients with acute decompensated heart failure or sepsis. No Phase 1 dose-escalation studies, Phase 2 efficacy trials, or Phase 3 confirmatory trials have been completed in humans. Published research consists primarily of mechanism-of-action studies rather than formal safety databases.
Common Side Effects
Experienced by some users
Mild discomfort at treatment site
Some users experience mild discomfort, which is among the most commonly reported effects with Adrenomedullin. This typically resolves within a few days as the body adjusts.
Management: Apply ice if needed. Rotate treatment sites. These symptoms typically improve within the first week of use.
Excessive blood pressure lowering (hypotension)
Adrenomedullin is a potent vasodilator, and hypotension occurs in 30-50% of patients receiving therapeutic doses (0.5-1.5 mcg/kg/min). Systolic BP typically drops 15-40 mmHg, and diastolic 10-25 mmHg. This is the primary dose-limiting toxicity. Risk is highest in patients already on antihypertensive therapy or with baseline volume depletion.
Management: Continuous blood pressure monitoring is essential—this should occur during infusions and frequently during initial treatment. Baseline and daily orthostatic vital signs are critical. Maintain adequate intravascular volume with IV fluids—liberal saline infusions often accompany adrenomedullin. Position patient upright gradually when standing. Hold other vasodilators and reduce antihypertensive agents. If systolic BP drops below 90 mmHg or becomes symptomatic (syncope, severe dizziness), reduce infusion rate or hold dose temporarily. Vasopressors (norepinephrine, dopamine) are available if severe hypotension develops.
Headaches (from pressure changes)
Headaches occur in 15-25% of patients, typically resulting from rapid blood pressure reductions and cerebral vasodilation. Headaches are usually mild-to-moderate, frontal or generalized, and appear within 30 minutes to 2 hours of infusion start. Most resolve within 4 hours of infusion completion.
Management: Headaches often reflect appropriate vasodilation and are not dangerous themselves. Ensure adequate hydration—dehydration worsens headaches. Position patient supine or semi-supine to optimize cerebral perfusion. Acetaminophen (650-1000 mg) or NSAIDs (ibuprofen 400 mg) may help, but avoid if patient has renal compromise (common in sepsis). Ice packs to the forehead/neck can provide relief. Most headaches improve once the body acclimates, usually within 24-48 hours of continued infusion. Report severe headache, vision changes, or neurological symptoms immediately.
Flushing and mild facial redness
Flushing (sudden facial warmth and redness) occurs in 20-35% of patients, typically at the start of infusion or with dose increases. This reflects cutaneous vasodilation and is direct evidence of the medication's vasodilatory activity. Episodes usually last 5-15 minutes and are cosmetically bothersome but not medically dangerous.
Management: Flushing is a normal sign of treatment effect and doesn't require intervention—inform patients this is expected. Keep room temperature cool and ensure adequate ventilation. Wet washclothes or ice packs on the face can provide comfort. Avoid hot drinks and warm blankets during treatment. Flushing typically diminishes as patients develop tolerance, usually within the first 2-3 hours of infusion. This side effect indicates active drug effect and doesn't warrant dose reduction unless accompanied by hypotension.
Dizziness or lightheadedness
Dizziness occurs in 15-30% of patients, primarily secondary to blood pressure reduction and possibly dysautonomia during septic states. Orthostatic dizziness is more common than positional vertigo. Severity correlates with BP drops and baseline volume status.
Management: Maintain supine or semi-upright position during infusion—patients receiving IV adrenomedullin are typically ICU-level and bed-bound. Rise position changes gradually if patient ambulates. Ensure adequate hydration and monitor urine output. Dizziness often improves as the body compensates and BP stabilizes. If dizziness is accompanied by syncope, severe hypotension, or altered mental status, reduce infusion rate or discontinue temporarily and notify provider. ECG monitoring should accompany treatment in unstable patients.
Mild electrolyte shifts
Adrenomedullin has natriuretic and diuretic properties—it increases sodium and water excretion through renal mechanisms. Electrolyte abnormalities (hyponatremia, hypokalemia) occur in 10-20% of patients with prolonged infusion, particularly those receiving concurrent aggressive IV hydration. Potassium can drop 0.3-0.7 mEq/L, and sodium may fall 2-5 mEq/L in 24-48 hours.
Management: Baseline electrolyte panel (sodium, potassium, magnesium, calcium) is essential. Monitor electrolytes daily during treatment, more frequently if infusion >24 hours. Replace losses judiciously—avoid hyperosmolar replacement as this can worsen outcomes in sepsis. Potassium supplementation (potassium chloride 20-40 mEq) may be needed if K+ drops below 3.5 mEq/L. Hold diuretics during adrenomedullin therapy unless specifically indicated. Monitor for signs of hyponatremia (confusion, seizure) or hypokalemia (cardiac arrhythmias, weakness).
Localized injection site reactions
When adrenomedullin is given IV or by central line, phlebitis (vein inflammation) occurs in 5-15% of patients receiving peripheral IV infusions. Central lines rarely show this issue. Local pain, erythema, and edema typically develop within 24 hours. Adrenomedullin is not vesicant, but irritation occurs due to pH and osmolarity.
Management: Central venous access is preferred for adrenomedullin if infusion duration >24 hours. If peripheral IV necessary, select large bore (18 gauge or larger) and change sites every 48-72 hours. Flush line frequently with normal saline. Observe for phlebitis signs: pain, erythema, warmth, cord-like vein appearance. Apply warm compresses post-infusion to manage mild phlebitis. Discontinue peripheral access and establish central line if significant phlebitis develops. No pharmacological prevention is indicated—mechanical management (site care, line rotation) is standard.
Increased urination (natriuretic effect)
Adrenomedullin is a natriuretic agent, and increased urine output occurs in 60-80% of patients. Urine output can increase 1.5-3 fold above baseline, with diuresis often exceeding 200 mL/hour. Sodium and water excretion both increase, which can be therapeutic in volume overload but problematic in euvolemic or hypovolemic patients.
Management: Monitor strict intake/output hourly during treatment—continuous urinary catheterization is standard in ICU settings where adrenomedullin is used. Weigh patient daily if possible. Replace urine losses carefully—excessive replacement can negate therapeutic diuresis and worsen pulmonary edema in heart failure patients. In sepsis, mild diuresis can improve oxygenation. Maintain serum sodium >130 mEq/L and K+ >3.5 mEq/L. Monitor for acute kidney injury—adrenomedullin can worsen renal function if urine losses aren't replaced. Discontinue if UO drops sharply, signaling possible renal dysfunction.
Stop and Seek Help If
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Adrenomedullin
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Adrenomedullin should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
Interactions
With other peptides
- ✓May be used together under medical guidance.
- ✓May be used together under medical guidance.
- ✓May be used together under medical guidance.
With medications
- !High-dose vasopressor medications - Use with caution—discuss with your healthcare provider.
- !Severe dehydration therapies - Use with caution—discuss with your healthcare provider.
- !Unmonitored blood pressure conditions - Use with caution—discuss with your healthcare provider.
With supplements
- ✓Multivitamins - Generally safe to take alongside Adrenomedullin. Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements - Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
Effectiveness
Does it
work?
Evidence Level
Moderate human trials
What to Expect
Minutes
What you might notice
- •Rapid onset of vasodilation effect
- •Blood vessel relaxation begins within minutes of IV administration
What's normal
- •Initial response to Adrenomedullin is beginning at the cellular level
- •Different individuals experience Adrenomedullin's onset at different rates
- •Transient systemic effects from initial Adrenomedullin exposure are common
What's next
- →Maintain consistent Adrenomedullin administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
Hours
What you might notice
- •Peak effects on blood pressure and organ perfusion
- •Sustained hemodynamic improvements observed
What's normal
- •Adrenomedullin is achieving sufficient receptor engagement
- •Initial mechanism of Adrenomedullin is taking effect
- •Early transient effects from Adrenomedullin administration are resolving
What's next
- →Maintain consistent Adrenomedullin administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
Research Duration
What you might notice
- •Continuous infusion (hours to days) in clinical trial protocols
- •Effects persist as long as peptide is present
What's normal
- •Full therapeutic effects of Adrenomedullin are well-characterized at this point
- •Maintenance of Adrenomedullin's therapeutic effects is typical
- •Tolerance patterns with Adrenomedullin are generally stable over months
What's next
- →Comprehensive assessment of Adrenomedullin efficacy should be conducted
- →Discuss long-term continuation, cycling, or protocol modifications
- →Continue regular monitoring of relevant biomarkers or symptoms
Signs It's Working
Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Adrenomedullin over time
- ✓Reduction in symptom frequency or severity
General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not Seeing Results?
Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key Research
"Early Use of Innovative Biomarkers Such as Mid-Regional Pro-Adrenomedullin and SeptiCyte RAPID in Post-Cardiac Surgery Patients: Pilot Case Series"
Risso C, Vay L, Sciascia F, 2025
Finding: Mid-regional pro-adrenomedullin proved valuable for detecting endothelial dysfunction and predicting organ failure after heart surgery. Patients with infections showed elevated pro-adrenomedullin levels, while those with routine surgery maintained normal levels, making it an excellent early warning marker.
View Study"The Role of Adrenomedullin as a Predictive Marker of the Risk of Death and Adverse Clinical Events: A Review of the Literature"
Sacco MA, Gualtieri S, Cordasco F, 2024
Finding: Elevated adrenomedullin levels consistently correlated with increased risk of death and severe complications across many diseases. This vasodilatory peptide serves as a powerful prognostic marker for patient stratification and therapeutic effectiveness monitoring.
View Study"Adrenomedullin: a novel hypotensive peptide isolated from human pheochromocytoma"
Kitamura K, Kangawa K, Kawamoto M, et al., 1993
Finding: This landmark discovery identified adrenomedullin as a novel 52-amino acid hormone with potent and long-lasting blood pressure-lowering effects. The peptide circulates in considerable concentrations and represents a new physiological system for circulation control alongside traditional hormone pathways.
View StudyFrequently Asked Questions