Peptide profile · Healing & Recovery
Nesiritide (BNP)
Recombinant B-type natriuretic peptide that helps your heart breathe easier by reducing fluid overload and improving blood flow during acute heart failure crises.
Written & reviewed by Michael Carroll · Research, Peptide Initiative
Typical dose
0.01 mcg/kg/min continuous infusion
Half-life
18 minutes (terminal elimination half-life)
Bioavailability
100% (intravenous administration)
Molecular weight
3464.0 Da
Evidence level
Strong human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
C143H244N50O42S4
Primary benefits
Nesiritide is one of the fastest-acting treatments for acute heart failure breathlessness, with 60% of benefits within 15 minutes of administration.
Powerfully increases urine output to safely remove dangerous fluid accumulation in the lungs and body tissues.
Directly relaxes blood vessels and reduces the pressure your heart must pump against, giving it crucial relief during crisis.
Scios (acquired by Johnson & Johnson)
Amino acid sequence
MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH02 · Dosing
How much do I take?
0.01 mcg/kg/min continuous infusion · continuous iv infusion
Intravenous: Delivered straight into a vein through a drip (IV), done by a clinician.
Bioavailability Complete (about 100%) — delivered straight into the bloodstream.
Best time to take
Nesiritide (BNP) is administered intravenously in a clinical setting. Timing is determined by your healthcare provider based on the treatment protocol and your medical needs.
With food?
IV administration of Nesiritide (BNP) is not dependent on meal timing. Your healthcare team will provide specific instructions regarding food and fluid intake around treatment sessions.
If stacking
Nesiritide (BNP) should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
＋ Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
－ Decrease if
- −Side effects are bothersome or impacting daily life despite management strategies
- −You experience any signs of an adverse reaction
- −Lab results indicate the need for dose reduction
- −Your healthcare provider recommends a lower dose based on your response
✓ Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Select Weight
Look for a number followed by 'mg' on the vial label (e.g., 5mg, 10mg)
03 · Suitability
Is this right for me?
Best for emergency stabilization of acute heart failure episodes & rapid relief of severe shortness of breath
Best for
Emergency stabilization of acute heart failure episodes
Nesiritide (BNP) is particularly well-suited for individuals focused on emergency stabilization of acute heart failure episodes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Rapid relief of severe shortness of breath
Nesiritide (BNP) is particularly well-suited for individuals focused on rapid relief of severe shortness of breath. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Reducing hospitalization time and improving outcomes
Nesiritide (BNP) is particularly well-suited for individuals focused on reducing hospitalization time and improving outcomes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Managing sudden fluid buildup in the lungs or legs
Nesiritide (BNP) is particularly well-suited for individuals focused on managing sudden fluid buildup in the lungs or legs. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Nesiritide (BNP) with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Intravenous (IV) bolus · Intravenous (IV) continuous infusion
Reconstitution — what you need
Example
Add the recommended volume of bacteriostatic water to the Nesiritide (BNP) vial. Gently swirl (do not shake) until the powder is fully dissolved. The resulting solution should be clear. Calculate your individual dose based on the concentration and your prescribed amount.
Your dose of Nesiritide (BNP) is determined by your healthcare provider. Using an insulin syringe marked in units, draw up the exact amount prescribed. For example, if the reconstituted concentration is 1mg/mL and your dose is 0.5mg, draw up 0.5mL (50 units on an insulin syringe). Always double-check calculations before injection.
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
Technique
- 01Wash your hands thoroughly with soap and water before handling supplies
- 02Clean the injection site with an alcohol swab and let it air dry completely
- 03Pinch a fold of skin at the chosen injection site
- 04Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 05Inject the medication slowly and steadily over 5-10 seconds
- 06Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 07Rotate injection sites to prevent tissue irritation or lipodystrophy
- 08Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage · before reconstitution
Store Nesiritide (BNP) in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.
Storage · after reconstitution
Once reconstituted, Nesiritide (BNP) should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.
Signs of degradation
Sample daily schedule
05 · Safety
Is it safe?
3 common side effects · 1 serious
FDA-approved nesiritide (Natrecor) demonstrates excellent safety in acute decompensated heart failure with rapid onset (15-minute half-life providing quick reversibility). Symptomatic hypotension occurs in 11% of patients, managed through continuous IV monitoring and dose titration. No serious adverse events, carcinogenicity, or renal dysfunction directly attributable to nesiritide in Phase III trials (n=700+). Tachyphylaxis (tolerance) can develop with prolonged infusions beyond 24-48 hours.
FDA approval supported by VMAC randomized trial demonstrating superior dyspnea relief versus dobutamine with improved hemodynamics (20% pulmonary capillary wedge pressure reduction). Invasive hemodynamic monitoring studies confirm natriuretic mechanism via guanylate cyclase activation with 25-40% urine sodium increases. Echocardiographic studies show preserved cardiac function without negative inotropic effects unlike sympathomimetics.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Nesiritide (BNP)
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Nesiritide (BNP) should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- ✓Furosemide — Loop diuretic that enhances fluid removal; nesiritide increases effectiveness by improving kidney blood flow
- ✓ACE Inhibitors (Lisinopril, Enalapril) — Complements nesiritide's vasodilation; both reduce cardiac workload and improve blood flow
- ✓Nitroglycerin — Another vasodilator that works synergistically to reduce heart strain and improve perfusion
With medications
- !Excessive diuretics — Combined effect can cause dangerous dehydration and kidney injury; must be carefully monitored
- !Other potent vasodilators in high doses — Risk of dangerously low blood pressure; requires careful dosage adjustment and monitoring
- !Nephrotoxic drugs (NSAIDs, contrast dye) — Nesiritide-related kidney effects may be worsened; avoid if possible during treatment
With supplements
- ✓Multivitamins — Generally safe to take alongside Nesiritide (BNP). Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
06 · Effectiveness
How do I know it's working?
Strong human trials · first signs 0-5 minutes
Evidence level
Strong human trials
(Phase 3 or FDA approved)
How it works
Nesiritide is synthetic B-type natriuretic peptide (BNP) that helps failing hearts work better. It relaxes blood vessels, reduces fluid volume, and helps the heart pump more efficiently—a powerful intervention for acute heart failure.
Nesiritide is recombinant BNP that activates natriuretic peptide receptors, increasing cGMP and causing vasodilation, natriuresis, and reduced aldosterone secretion. Reduces cardiac preload and afterload while improving cardiac output.
What to expect
0-5 minutes
What you might notice
- •The medication enters your bloodstream rapidly
- •You may feel a slight sensation at the injection site
- •Initial bolus injection given
What's normal
- •Initial response to Nesiritide (BNP) is beginning at the cellular level
- •Different individuals experience Nesiritide (BNP)'s onset at different rates
- •Transient systemic effects from initial Nesiritide (BNP) exposure are common
What's next
- →Maintain consistent Nesiritide (BNP) administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
5-15 minutes
What you might notice
- •You typically notice improvement in breathing difficulty
- •Your heart rate and blood pressure begin adjusting
- •About 60% of the total 3-hour benefit is usually achieved by this time
- •Effects begin
What's normal
- •Nesiritide (BNP) is achieving sufficient receptor engagement
- •Initial mechanism of Nesiritide (BNP) is taking effect
- •Early transient effects from Nesiritide (BNP) administration are resolving
What's next
- →Maintain consistent Nesiritide (BNP) administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
15-60 minutes
What you might notice
- •Most patients reach 95% of their expected benefit from the medication
- •Shortness of breath significantly improves
- •Urine production increases noticeably
- •Peak relief achieved
What's normal
- •Nesiritide (BNP) is achieving sufficient receptor engagement
- •Initial mechanism of Nesiritide (BNP) is taking effect
- •Early transient effects from Nesiritide (BNP) administration are resolving
What's next
- →Maintain consistent Nesiritide (BNP) administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
1-6 hours
What you might notice
- •Effects plateau at their maximum level
- •Your medical team monitors kidney function and blood pressure continuously
- •Most patients feel dramatically better
- •Continued symptom improvement
What's normal
- •Nesiritide (BNP) is achieving sufficient receptor engagement
- •Initial mechanism of Nesiritide (BNP) is taking effect
- •Early transient effects from Nesiritide (BNP) administration are resolving
What's next
- →Maintain consistent Nesiritide (BNP) administration as prescribed
- →Document subjective effects and physical markers daily
- →Schedule a check-in with your provider about initial observations
6-24 hours
What you might notice
- •Depending on your condition, the IV drip may continue, be adjusted, or be discontinued
- •If stopped, effects wear off within 30 minutes due to the short 18-minute half-life
- •Infusion continues or stops
What's normal
- •Nesiritide (BNP) response patterns are emerging
- •Initial Nesiritide (BNP) response is consistent with mechanism expectations
- •Early tolerance development to Nesiritide (BNP) is not expected
What's next
- →Assess whether Nesiritide (BNP) response aligns with expectations
- →Plan next steps based on initial Nesiritide (BNP) tolerance and response
- →Establish baseline monitoring for Nesiritide (BNP) response tracking
Signs it's working · Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Nesiritide (BNP) over time
- ✓Reduction in symptom frequency or severity
Signs it's working · General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key research
07 · Questions
Frequently asked
How quickly does nesiritide work?+
Nesiritide is one of the fastest-acting heart failure medications. Most patients notice improvement in breathing within 5-15 minutes of receiving the initial bolus dose. About 60% of the medication's effect is usually achieved within 15 minutes, and 95% within one hour. This rapid action makes it ideal for emergency situations.
Can I take nesiritide at home?+
No. Nesiritide must be administered intravenously by medical professionals in a hospital, emergency room, or specialized infusion center. It requires continuous monitoring of your heart rate, blood pressure, and kidney function. The medication cannot be given by injection under the skin or taken by mouth.
What happens if nesiritide causes low blood pressure?+
Low blood pressure is one of the most common side effects. Your medical team actively monitors this and can adjust the dose, slow the infusion rate, or add extra fluids through an IV to raise your blood pressure back up. In most cases, they can manage this by adjusting the nesiritide dose without stopping it entirely.
Can nesiritide damage my kidneys?+
Nesiritide can occasionally cause a temporary decline in kidney function, especially in patients with existing kidney problems. This is why your medical team checks kidney function before, during, and after treatment. The good news is that nesiritide's kidney effects are usually reversible once the medication is stopped. Your doctor will decide if nesiritide is appropriate for you based on your kidney function.
How is nesiritide different from other heart failure medications?+
Nesiritide is unique because it's the only medication that's a recombinant copy of your body's natural BNP hormone. It works faster than most oral heart medications and provides relief within minutes rather than days or weeks. However, it only works intravenously in acute settings, whereas drugs like ACE inhibitors can be taken at home long-term. Nesiritide is designed for emergency crisis management, not ongoing maintenance therapy.
Will nesiritide cure my heart failure?+
No. Nesiritide provides temporary relief of acute symptoms but doesn't cure heart failure or repair the underlying heart damage. Think of it as a lifeline during a crisis. After the acute episode improves, you'll need to take other long-term medications and make lifestyle changes to manage your heart condition going forward.
How long can I stay on nesiritide?+
Nesiritide is designed for short-term acute use, typically during a hospital stay. Most patients receive it for 24-72 hours. It's not appropriate for long-term home use. After stabilization, you'll transition to oral medications and follow-up with your cardiologist.
08 · Further reading
History & related research
History · since 1988
The heart's own healing signal, recreated in the lab to help failing hearts.
Nesiritide is an exact copy of a natural protein your heart makes when it is struggling. When your heart fails, your body tries to heal itself by releasing this protein.
Read the full history of Nesiritide (BNP)Studied for