Pramlintide
Synthetic amylin analog for comprehensive postprandial glucose control with insulin therapy
Written by Michael Carroll — Owner, Director of Research · Reviewed by the Peptide Initiative Research Team · Editorial standards
Suggested dose
15 – 120 mcg
15 mcg per meal (type 1 diabetes)
Titrate up after 3+ days without significant nausea
30-60 mcg per meal (type 1 diabetes)
Ongoing, as tolerated
60 mcg per meal, titrating to 120 mcg (type 2 diabetes)
Increase to 120 mcg after 3+ days without significant nausea
Compound profile
Scientific & efficacy data
Weight Management
Peptide profile
Strong human trials
Pramlintide
15 mcg per meal (type 1 diabetes) · Once daily
Molecular formula
C171H267N51O53S2
- Mol. weight
- 3,949 Da
- CAS number
- 196078-30-5
- PubChem
- 70691388
- Developed · 1996
- Amylin Pharmaceuticals (AstraZeneca)
Amylin Pharmaceuticals / AstraZeneca
Amino acid sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYBlood Sugar Control
Powerful postprandial glucose regulation through glucagon suppression, gastric emptying delay, and satiety — addressing the amylin deficiency component of diabetes
Weight Management
Clinically meaningful weight loss of 1-2 kg through centrally mediated satiety, particularly beneficial for insulin-treated patients who typically gain weight
Metabolic Health
Restores the amylin arm of glucose homeostasis that is lost in insulin-dependent diabetes, enabling more physiological glucose regulation
Dosing
How much do I take?
15 mcg per meal (type 1 diabetes), titrated to 60 mcg per meal, titrating to 120 mcg (type 2 diabetes) · immediately before each major meal
15 – 120 mcg
Immediately before each major meal
Covers all 3 documented dose levels · timing · dose-adjustment guidance.
Suitability
Is this right for me?
Best for improving postprandial glucose control in insulin-treated diabetes & reducing insulin dose requirements while maintaining glycemic control
Best for
Improving postprandial glucose control in insulin-treated diabetes
Pramlintide is particularly well-suited for individuals focused on improving postprandial glucose control in insulin-treated diabetes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Reducing insulin dose requirements while maintaining glycemic control
Pramlintide is particularly well-suited for individuals focused on reducing insulin dose requirements while maintaining glycemic control. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Supporting weight management in insulin-treated T1DM and T2DM patients
Pramlintide is particularly well-suited for individuals focused on supporting weight management in insulin-treated t1dm and t2dm patients. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Addressing amylin deficiency in insulin-dependent diabetes
Pramlintide is particularly well-suited for individuals focused on addressing amylin deficiency in insulin-dependent diabetes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Pramlintide with similar peptides to find the best fit for your goals.
Administration
How do I use it?
subcutaneous injection
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
Covers reconstitution · step-by-step technique · storage · a sample daily schedule.
Safety
Is it safe?
3 common side effects · 2 serious
FDA-approved pramlintide demonstrates good tolerability in insulin-treated diabetes with well-characterized safety profile from >20 years clinical use.
Gastrointestinal side effects (nausea) occur in 30-50% of initiators but typically resolve within 1-3 weeks. Hypoglycemia risk, especially when combined with insulin, requires dose coordination and patient education.
Pancreatic side effects theoretically possible but not documented in clinical trials. Pregnancy category C requires careful consideration.
FDA approval supported by diabetes randomized trials (n=1000+) demonstrating HbA1c reductions of 0.5-1.0% with weight loss of 1-2 kg over 6 months.
Mechanistic studies via stable-isotope glucose tracer methodology show slowed gastric emptying (50-60% reduction in gastric output rate) and inhibited glucagon secretion. Postprandial glucose improvements measured at 2-3 hours post-meal with 40-50 mg/dL average reductions versus placebo.
Common side effects · experienced by some users
Nausea
The most common side effect, affecting 30-50% of patients during initiation. Usually mild to moderate and related to pramlintide's gastric emptying effects. Typically transient.
Management: Start at the lowest recommended dose and titrate slowly. Nausea generally resolves within 1-2 weeks. Eat smaller meals. If severe, pause titration or temporarily reduce dose. Do not increase dose until nausea subsides.
Reduced Appetite / Anorexia
Decreased appetite is reported in 10-15% of patients and is a consequence of pramlintide's central satiety-promoting mechanism in the hypothalamus and area postrema.
Management: This effect often contributes to the desired weight loss benefit. Ensure adequate caloric and nutritional intake. If excessive or concerning, consult healthcare provider about dose adjustment.
Headache
Reported in approximately 5-13% of patients. Often occurs during the initiation phase and may be related to metabolic adjustments or blood glucose fluctuations.
Management: Usually resolves with continued treatment. Standard analgesics may be used. Ensure blood glucose is stable — headache may indicate hypo- or hyperglycemia requiring glucose review.
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- Severe or worsening side effects that don't improve with dose adjustment or supportive care
- Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- Your healthcare provider recommends discontinuation based on your clinical response
- Development of any new medical condition that may be contraindicated with Pramlintide
- Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- Abnormal lab results or clinical markers that suggest adverse effects
Pramlintide should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- Safe:Insulin (Rapid-Acting) — Essential co-administration — pramlintide is only indicated for use alongside mealtime insulin. Reduces required insulin dose while improving postprandial control.
- Safe:Insulin Glargine — Basal insulin provides fasting glucose coverage while pramlintide addresses postprandial glucose spikes and insulin dose optimization
- Safe:Metformin — In type 2 diabetes, metformin's insulin-sensitizing action complements pramlintide's postprandial glucose control and weight benefit
With medications
- Caution:Sulfonylureas — Increased risk of severe hypoglycemia due to non-glucose-dependent insulin secretion combined with pramlintide's glucose-lowering effects
- Caution:Alpha-Glucosidase Inhibitors — Both agents slow gastric emptying and nutrient absorption, potentially leading to excessive GI side effects and unpredictable glucose patterns
- Caution:GLP-1 Receptor Agonists — Overlapping mechanisms of gastric emptying delay and appetite suppression with increased GI side effects and hypoglycemia risk
With supplements
- Safe:Multivitamins — Generally safe to take alongside Pramlintide. Space doses apart if taking oral formulations to ensure optimal absorption.
- Safe:Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
Effectiveness
How do I know it's working?
Strong human trials · first signs weeks 1-2
Evidence level
Strong human trials
(Phase 3 or FDA approved)
Regulatory status
FDA approved for this use
Onset of effects
Moderate
(1-2 weeks)
How it works
Pramlintide is a synthetic copy of amylin, a hormone your pancreas naturally makes alongside insulin.
It slows down how fast food leaves your stomach, tells your brain when you're full, and stops your liver from releasing too much glucose after meals. Think of it as a helper hormone that works with insulin to keep blood sugar steady and help you lose weight.
The deeper mechanism
Pramlintide is a 37-amino acid synthetic amylin analog (Pro25, Pro28, Pro29-substituted human amylin) that acts as a selective amylin receptor agonist, activating amylin receptor 1 (AmyR1)—a heteromeric receptor complex composed of calcitonin receptor (CALCR) and receptor activity-modifying protein 1 (RAMP1).
At peripheral sites, amylin receptor activation on vagal afferents suppresses postprandial glucagon secretion through a glucose-dependent mechanism and delays gastric emptying via direct effects on gastric smooth muscle innervation, both reducing postprandial glucose excursions.
Centrally, amylin receptors in the hypothalamus (particularly in the ventromedial hypothalamus and amygdala) mediate appetite suppression and promote satiety signaling, contributing to reduced food intake and weight loss.
Unlike insulin (which is glucose-independent and can cause hypoglycemia), amylin's glucagon suppression only occurs when blood glucose is elevated, providing inherent hypoglycemia protection.
Pramlintide also enhances energy expenditure through central mechanisms and may have neuroprotective effects, with emerging evidence suggesting amylin may play a role in preventing cognitive decline associated with diabetes.
What to expect
Weeks 1-2
What you might notice
- Reduced postprandial glucose spikes, possible nausea, reduced appetite
- Blood glucose may be lower than expected — monitor closely due to 50% insulin dose reduction
What's normal
- Nausea is very common and expected
- Blood glucose patterns will change significantly
- You may feel less hungry after meals
- Some patients notice flatter post-meal glucose curves within the first few days
What's next
- Continue at starting dose
- Begin gradual insulin retitration based on blood glucose data
- If nausea resolves, prepare for dose escalation as tolerated
Weeks 3-8
What you might notice
- Improving postprandial glucose control, diminishing nausea, early weight stabilization or loss, ability to titrate to maintenance dose
What's normal
- Nausea typically resolves by week 3-4
- Appetite suppression continues but becomes manageable
- Insulin doses are gradually being retitrated upward toward optimal glycemic targets
- Weight may begin to decrease
What's next
- Achieve and maintain target maintenance dose (120 mcg T2DM or 60 mcg T1DM per meal)
- Fine-tune insulin dosing based on blood glucose patterns
Weeks 12-24
What you might notice
- Stable glycemic control with reduced HbA1c, sustained weight loss of 1-2 kg, reduced overall insulin requirements compared to baseline
What's normal
- HbA1c reduction of 0
- 6% is typical
- Weight loss plateaus at 1-2 kg
- Postprandial glucose excursions are significantly reduced
- Mealtime insulin doses are typically 10-30% lower than pre-pramlintide levels after retitration
What's next
- Continue maintenance therapy with ongoing blood glucose monitoring
- Reassess HbA1c every 3 months
- Adjust insulin as needed for sustained optimal control
Signs it's working
Treatment Response
- Improvement in the primary symptoms or condition being treated
- Positive changes in relevant lab values or clinical markers
- Consistent, stable response to Pramlintide over time
- Reduction in symptom frequency or severity
General Well-being
- Improved energy levels and daily functioning
- Better quality of life related to the treated condition
- Manageable or absent side effects indicating good tolerance
- Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- Insufficient time at target dose—most compounds need several weeks to show full benefits
- Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- Individual variation in response—genetics, metabolism, and other factors affect outcomes
- Underlying conditions or medications interfering with absorption or effectiveness
- Improper storage leading to degraded product—always verify proper storage conditions
Key research
Clinical trials
Tested in people
60 registered studies, 4 still enrolling.
By phase
A trial spanning two phases is counted in both, so these can sum above the total. Observational studies carry no phase.
What kind of research
About 4,559 people took part in the studies that actually administered Pramlintide. Observational studies analyse the records of people already taking it — nobody was given anything for the study, so they are counted separately and cannot show cause and effect.
Most recent
Postprandial Regulation of Bone Perfusion in Healthy Individuals
University of Copenhagen
Pancreatic Polypeptide as a Modulator of Amylin- Induced Satiety in Healthy Humans
University Hospital, Gentofte, Copenhagen
Amylin-Induced Migraine Attacks Without Aura
Danish Headache Center
Sources: ClinicalTrials.gov, the EU Clinical Trials Information System and ISRCTN, deduplicated so a study registered twice is counted once. A study is counted when Pramlintide is named as an intervention; studies that only mention it in passing are not.
Questions
Frequently asked
Why does pramlintide have a BLACK BOX WARNING?
Pramlintide carries an FDA BLACK BOX WARNING for severe hypoglycemia because it is always used in combination with insulin. The combined glucose-lowering effects can cause dangerous drops in blood sugar, particularly during the first weeks of therapy. To mitigate this risk, the FDA mandates that mealtime insulin doses be reduced by 50% when starting pramlintide. Close blood glucose monitoring is essential, and patients must have rapid-acting glucose available at all times.
What is amylin and why is pramlintide needed?
Amylin (islet amyloid polypeptide) is a hormone naturally co-secreted with insulin by pancreatic beta cells after meals. It plays a crucial role in glucose regulation by suppressing glucagon, slowing gastric emptying, and promoting satiety. In type 1 diabetes, amylin is completely absent due to beta cell destruction. In advanced type 2 diabetes, amylin secretion is severely impaired. Pramlintide replaces this missing hormone, restoring a key component of normal glucose homeostasis that insulin alone cannot address.
Can pramlintide be mixed with insulin in the same syringe?
No, pramlintide must never be mixed with any type of insulin. The pH of pramlintide solution is different from insulin formulations, and mixing can alter the pharmacokinetics of both drugs. Pramlintide and insulin must be administered as separate injections at separate injection sites, at least 2 inches apart.
Why were proline substitutions made to create pramlintide from native amylin?
Native human amylin has a strong tendency to self-aggregate and form amyloid fibrils (the same fibrils found in pancreatic islet amyloid deposits in type 2 diabetes). This aggregation makes native amylin pharmaceutically unstable and unsuitable as a drug. The three proline substitutions at positions 25, 28, and 29 were based on rat amylin, which naturally contains prolines at these positions and does not aggregate. These substitutions disrupt the beta-sheet formation that drives amyloid aggregation while preserving full biological activity at amylin receptors.
Is pramlintide suitable for all patients with diabetes?
No. Pramlintide is specifically indicated for patients with type 1 or type 2 diabetes who are already on mealtime insulin therapy and have not achieved adequate postprandial glucose control. It is contraindicated in patients with gastroparesis, hypoglycemia unawareness, and those who cannot reliably comply with the critical insulin dose reduction requirements. It is not a standalone therapy and is not appropriate for patients not using insulin.
How does pramlintide differ from GLP-1 receptor agonists?
While both pramlintide and GLP-1 receptor agonists slow gastric emptying and promote satiety, they work through entirely different receptor systems. Pramlintide activates amylin receptors (AMY1/2/3), while GLP-1 RAs activate the GLP-1 receptor. Key differences include: pramlintide must be given with insulin (adjunctive only), GLP-1 RAs can be used independently; pramlintide suppresses glucagon via amylin receptors, GLP-1 RAs stimulate glucose-dependent insulin secretion; pramlintide has a very short half-life (~48 min) requiring injection before each meal, while most modern GLP-1 RAs are once-weekly.
Further reading
History & related research
History · since 1987
The Missing Half of Insulin's Story
From a forgotten hormone hiding in pancreatic deposits to the only FDA-approved amylin replacement — follow the quest to understand why insulin alone wasn't enough, why human amylin is toxic, and how borrowing a rat's chemistry solved a 40-year-old mystery.
Read the full history of PramlintideReady for the protocol?
Every dosing tier, administration route, timing note, and dose-adjustment rule for Pramlintide, on one page.