Peptide Profile
Pramlintide
Synthetic amylin analog for comprehensive postprandial glucose control with insulin therapy
Compound Profile
Scientific & Efficacy Data
C171H267N51O53S2
Molecular Formula
3,949 Da
Molecular Weight
~48 minutes
Half-Life
30-40% subcutaneous bioavailability
Bioavailability
196078-30-5
CAS #
70691388
PubChem ID ↗
Developed By · 1996
Amylin Pharmaceuticals (AstraZeneca)
Amylin Pharmaceuticals / AstraZeneca
Primary Benefits
Powerful postprandial glucose regulation through glucagon suppression, gastric emptying delay, and satiety — addressing the amylin deficiency component of diabetes
Clinically meaningful weight loss of 1-2 kg through centrally mediated satiety, particularly beneficial for insulin-treated patients who typically gain weight
Restores the amylin arm of glucose homeostasis that is lost in insulin-dependent diabetes, enabling more physiological glucose regulation
Amino Acid Sequence
KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYDosing
How much
do I take?
Subcutaneous: A small injection into the fatty layer just under the skin — the same way insulin is given.
Bioavailability High — most of the dose reaches your bloodstream, just more gradually than an IV.
Starting Dose
15 mcg per meal (type 1 diabetes)
FDA Symlin label starting dose for type 1 diabetes. Inject before each major meal (>=250 kcal or >=30 g carbohydrate); reduce mealtime insulin by 50% when starting. [6]
Standard Dose
30-60 mcg per meal (type 1 diabetes)
Type 1 maintenance target per FDA label: titrate 15 -> 30 -> 45 -> 60 mcg, stepping up each time no significant nausea occurs for 3+ days; settle at 30 or 60 mcg as tolerated. [6]
Standard Dose
60 mcg per meal, titrating to 120 mcg (type 2 diabetes)
FDA Symlin label for type 2 diabetes: start 60 mcg, advance to 120 mcg maintenance as tolerated. Separate injection from insulin; cut mealtime insulin 50% at start. [6]
Timing
Best time to take
Administer Pramlintide at the same time each day (or on the same day each week for weekly injections). Many users prefer morning or evening administration. Pick a time you'll remember consistently.
With food?
Pramlintide injections can be given regardless of meal timing. However, if GI effects occur, administering on an empty stomach or with a light meal may help reduce discomfort.
If stacking
Pramlintide should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
Adjusting Your Dose
Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
Decrease if
- -Side effects are bothersome or impacting daily life despite management strategies
- -You experience any signs of an adverse reaction
- -Lab results indicate the need for dose reduction
- -Your healthcare provider recommends a lower dose based on your response
Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
Suitability
Is this
right for me?
Best For
Improving postprandial glucose control in insulin-treated diabetes
Pramlintide is particularly well-suited for individuals focused on improving postprandial glucose control in insulin-treated diabetes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Reducing insulin dose requirements while maintaining glycemic control
Pramlintide is particularly well-suited for individuals focused on reducing insulin dose requirements while maintaining glycemic control. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Supporting weight management in insulin-treated T1DM and T2DM patients
Pramlintide is particularly well-suited for individuals focused on supporting weight management in insulin-treated t1dm and t2dm patients. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Addressing amylin deficiency in insulin-dependent diabetes
Pramlintide is particularly well-suited for individuals focused on addressing amylin deficiency in insulin-dependent diabetes. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider Alternatives If
Goal: Alternative approaches for weight management support
Consider: Consult your healthcare provider for alternatives to Pramlintide based on your specific needs and medical history
Goal: Alternative weight management approaches
Consider: Semaglutide (Wegovy/Ozempic), Liraglutide (Saxenda), AOD-9604
Goal: Non-injectable weight management
Consider: Oral semaglutide (Rybelsus), Phentermine-topiramate (Qsymia), Lifestyle modifications
Who Should Avoid
Do not use if
- ×Confirmed gastroparesis requiring treatment
- ×Hypoglycemia unawareness (inability to recognize hypoglycemic symptoms)
- ×Known hypersensitivity to pramlintide or metacresol
- ×Pediatric patients (safety not established in children)
Use with caution if
- !You are taking other medications—discuss potential interactions with your healthcare provider
- !You have a history of liver or kidney disease
- !You are elderly or have multiple medical conditions
- !You are planning surgery in the near future—inform your surgeon about Pramlintide use
- !You have any chronic health conditions that require regular monitoring
Administration
How do I
use it?
Reconstitution
What you need
- •Pramlintide vial (lyophilized powder or solution)
- •Bacteriostatic water or sterile sodium chloride for reconstitution
- •Alcohol swabs for cleaning vial tops and injection sites
- •Appropriately sized syringes with fine-gauge needles (27-30 gauge)
- •Sharps disposal container
Injection
Route
Subcutaneous injection (into the fatty tissue just under the skin)—allows for consistent absorption and can be self-administered at home after proper training
Best sites
- •Abdomen (stomach area)—at least 2 inches from the belly button, most popular choice for self-injection
- •Front of thighs—middle to upper portion of the outer leg
- •Back of upper arm—outer area (may need assistance from another person)
Technique
- 1.Wash your hands thoroughly with soap and water before handling supplies
- 2.Clean the injection site with an alcohol swab and let it air dry completely
- 3.Pinch a fold of skin at the chosen injection site
- 4.Insert the needle at a 45-90 degree angle (depending on needle length and body composition)
- 5.Inject the medication slowly and steadily over 5-10 seconds
- 6.Release the skin fold and remove the needle, applying gentle pressure with a clean swab
- 7.Rotate injection sites to prevent tissue irritation or lipodystrophy
- 8.Dispose of the needle safely in a sharps container—never recap or reuse needles
Storage
Signs of degradation
Sample Daily Schedule
Safety
Is it
safe?
Safety Profile
FDA-approved pramlintide demonstrates good tolerability in insulin-treated diabetes with well-characterized safety profile from >20 years clinical use. Gastrointestinal side effects (nausea) occur in 30-50% of initiators but typically resolve within 1-3 weeks. Hypoglycemia risk, especially when combined with insulin, requires dose coordination and patient education. Pancreatic side effects theoretically possible but not documented in clinical trials. Pregnancy category C requires careful consideration.
FDA approval supported by diabetes randomized trials (n=1000+) demonstrating HbA1c reductions of 0.5-1.0% with weight loss of 1-2 kg over 6 months. Mechanistic studies via stable-isotope glucose tracer methodology show slowed gastric emptying (50-60% reduction in gastric output rate) and inhibited glucagon secretion. Postprandial glucose improvements measured at 2-3 hours post-meal with 40-50 mg/dL average reductions versus placebo.
Common Side Effects
Experienced by some users
Nausea
The most common side effect, affecting 30-50% of patients during initiation. Usually mild to moderate and related to pramlintide's gastric emptying effects. Typically transient.
Management: Start at the lowest recommended dose and titrate slowly. Nausea generally resolves within 1-2 weeks. Eat smaller meals. If severe, pause titration or temporarily reduce dose. Do not increase dose until nausea subsides.
Reduced Appetite / Anorexia
Decreased appetite is reported in 10-15% of patients and is a consequence of pramlintide's central satiety-promoting mechanism in the hypothalamus and area postrema.
Management: This effect often contributes to the desired weight loss benefit. Ensure adequate caloric and nutritional intake. If excessive or concerning, consult healthcare provider about dose adjustment.
Headache
Reported in approximately 5-13% of patients. Often occurs during the initiation phase and may be related to metabolic adjustments or blood glucose fluctuations.
Management: Usually resolves with continued treatment. Standard analgesics may be used. Ensure blood glucose is stable — headache may indicate hypo- or hyperglycemia requiring glucose review.
Less Common
- •Abdominal Pain and Vomiting
- •Injection Site Reactions
These typically resolve with continued use or dose adjustment.
Stop and Seek Help If
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Pramlintide
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Pramlintide should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
Interactions
With other peptides
- ✓Essential co-administration — pramlintide is only indicated for use alongside mealtime insulin. Reduces required insulin dose while improving postprandial control.
- ✓Basal insulin provides fasting glucose coverage while pramlintide addresses postprandial glucose spikes and insulin dose optimization
- ✓In type 2 diabetes, metformin's insulin-sensitizing action complements pramlintide's postprandial glucose control and weight benefit
With medications
- !Sulfonylureas - Increased risk of severe hypoglycemia due to non-glucose-dependent insulin secretion combined with pramlintide's glucose-lowering effects
- !Alpha-Glucosidase Inhibitors - Both agents slow gastric emptying and nutrient absorption, potentially leading to excessive GI side effects and unpredictable glucose patterns
- !GLP-1 Receptor Agonists - Overlapping mechanisms of gastric emptying delay and appetite suppression with increased GI side effects and hypoglycemia risk
With supplements
- ✓Multivitamins - Generally safe to take alongside Pramlintide. Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements - Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
Effectiveness
Does it
work?
Evidence Level
Strong human trials
What to Expect
Weeks 1-2
What you might notice
- •Reduced postprandial glucose spikes, possible nausea, reduced appetite
- •Blood glucose may be lower than expected — monitor closely due to 50% insulin dose reduction
What's normal
- •Nausea is very common and expected
- •Blood glucose patterns will change significantly
- •You may feel less hungry after meals
- •Some patients notice flatter post-meal glucose curves within the first few days
What's next
- →Continue at starting dose
- →Begin gradual insulin retitration based on blood glucose data
- →If nausea resolves, prepare for dose escalation as tolerated
Weeks 3-8
What you might notice
- •Improving postprandial glucose control, diminishing nausea, early weight stabilization or loss, ability to titrate to maintenance dose
What's normal
- •Nausea typically resolves by week 3-4
- •Appetite suppression continues but becomes manageable
- •Insulin doses are gradually being retitrated upward toward optimal glycemic targets
- •Weight may begin to decrease
What's next
- →Achieve and maintain target maintenance dose (120 mcg T2DM or 60 mcg T1DM per meal)
- →Fine-tune insulin dosing based on blood glucose patterns
Weeks 12-24
What you might notice
- •Stable glycemic control with reduced HbA1c, sustained weight loss of 1-2 kg, reduced overall insulin requirements compared to baseline
What's normal
- •HbA1c reduction of 0
- •6% is typical
- •Weight loss plateaus at 1-2 kg
- •Postprandial glucose excursions are significantly reduced
- •Mealtime insulin doses are typically 10-30% lower than pre-pramlintide levels after retitration
What's next
- →Continue maintenance therapy with ongoing blood glucose monitoring
- →Reassess HbA1c every 3 months
- →Adjust insulin as needed for sustained optimal control
Signs It's Working
Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Pramlintide over time
- ✓Reduction in symptom frequency or severity
General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not Seeing Results?
Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key Research
[1]"Pramlintide as an Adjunct to Insulin Therapy in Type 2 Diabetes: Systematic Review and Meta-Analysis"
Singh-Franco D, Perez A, Harrington C, 2024
Finding: Pramlintide is the first and only approved amylin analog, helping people with diabetes manage blood sugar and weight by suppressing glucagon, delaying stomach emptying, and boosting energy expenditure—working as a precision medicine approach for multi-hormone diabetes issues.
View Study[2]"Pramlintide for the Treatment of Type 1 and Type 2 Diabetes Mellitus"
Younk LM, Mikeladze M, Davis SN, 2011
Finding: When added to insulin pump therapy, pramlintide reduced blood sugar spikes after meals by up to 20 percent and helped patients lose an average of 2 to 3 kilograms while cutting their mealtime insulin doses by nearly 28 percent over 6 months.
View Study[3]"Amylin Physiology and Its Role in Diabetes Management"
Hay DL, Chen S, Lutz TA, Parkes DG, Roth JD, 2015
Finding: In a 29-week study of type 1 diabetes patients on insulin, pramlintide cut postprandial blood sugar surges by nearly 2.7 times more than placebo and reduced body weight by 1.3 kilograms, without increasing dangerous low blood sugar episodes.
View Study[4]"Pramlintide: A Review of Its Use in the Management of Insulin-Requiring Diabetes Mellitus"
Ryan GJ, Jobe LJ, Martin R, 2005
Finding: Research demonstrates pramlintide's effectiveness in improving glucose control across diverse patient populations with insulin-treated diabetes.
View Study[5]"Pramlintide Acetate: An Adjunctive Therapy for Type 1 and Type 2 Diabetes"
Schmitz O, Brock B, Rungby J, 2004
Finding: Beyond blood sugar control, amylin (pramlintide) acts as a brain satiety signal that reduces hunger and weight, and emerging evidence suggests it may protect against Alzheimer's disease by reducing neurodegeneration in the brain.
View Study[6]"SYMLIN (pramlintide acetate) injection - FDA Prescribing Information (DailyMed)"
AstraZeneca Pharmaceuticals, 2015
View StudyFrequently Asked Questions