Peptide profile · Immune
Cathelicidin (hCAP-18 / Synthetic Derivatives)
Human cationic antimicrobial protein-18 (hCAP-18) precursor and its synthetic derivative SAAP-148 — a next-generation 24-amino-acid cathelicidin-based peptide with broad-spectrum bactericidal activity against multidrug-resistant ESKAPE pathogens including MRSA biofilms, superior potency to its parent fragment LL-37, and retained efficacy under physiological salt and plasma conditions
Written & reviewed by Michael Carroll · Research, Peptide Initiative
Typical dose
0.5 mg/mL drops (about 100 microliters per application)
Half-life
Plasma half-life: minutes (proteolytic degradation); local tissue persistence: hours at therapeutic concentrations in wound environment; enhanced stability compared to LL-37 due to N-terminal acetylation and C-terminal amidation
Bioavailability
Topical bioavailability optimized in hypromellose ointment formulations; SAAP-148 retains activity in human plasma unlike LL-37; systemic bioavailability limited by proteolytic degradation
Molecular weight
hCAP-18 precursor: ~18,000 Da; SAAP-148: 3,267.1 Da; OP-145: ~2,900 Da
Evidence level
Moderate human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
hCAP-18: ~18 kDa precursor protein (170 AA); SAAP-148: C155H253N49O31 (approximate), MW 3,267.1 Da
Primary benefits
Synthetic versions like SAAP-148 kill dangerous superbugs in lab tests, including MRSA and other bacteria that resist normal antibiotics.
These peptides break through sticky bacterial shields called biofilms that protect infections on wounds and medical devices from treatment.
Your body naturally makes cathelicidin when vitamin D levels are good, helping white blood cells find and destroy harmful germs faster.
Naturally occurring; clinical development by various biotech companies
Amino acid sequence
[LL-37, 37 aa]02 · Dosing
How much do I take?
0.5 mg/mL drops (about 100 microliters per application) · twice daily
Topical: Applied onto the skin as a cream, gel, or lotion — it works mainly where you put it.
Bioavailability Local — acts mainly at the skin; little reaches the bloodstream.
Best time to take
Apply Cathelicidin (hCAP-18 / Synthetic Derivatives) to clean, dry skin. For best results, use consistently at the same time(s) each day. Evening application is often preferred to allow overnight absorption, unless otherwise directed.
With food?
As a topical product, Cathelicidin (hCAP-18 / Synthetic Derivatives) is not affected by food intake. Apply to clean skin and allow adequate absorption time before covering the area.
If stacking
Cathelicidin (hCAP-18 / Synthetic Derivatives) should be used as directed by your healthcare provider. If combining with other medications or supplements, discuss potential interactions with your provider. Avoid combining with compounds that have overlapping mechanisms unless specifically guided by a medical professional.
+ Increase if
- +You've tolerated the current dose for the recommended period without significant side effects
- +Therapeutic goals haven't been met at the current dose level
- +Your healthcare provider recommends dose escalation based on your response
- +Lab work or clinical assessments support a higher dose
- Decrease if
- −Side effects are bothersome or impacting daily life despite management strategies
- −You experience any signs of an adverse reaction
- −Lab results indicate the need for dose reduction
- −Your healthcare provider recommends a lower dose based on your response
✓ Signs of right dose
- ✓Therapeutic goals being met with minimal side effects
- ✓Stable and consistent response to treatment
- ✓Lab values or clinical markers trending in the right direction
- ✓Good tolerance with manageable or absent side effects
Dosing Calculator
Calculate Your Exact Dose
Step 1: Peptide Weight
Find the weight printed on your peptide vial label
Look here!
The peptide weight is printed on the label
Look here!
The weight is on the label
03 · Suitability
Is this right for me?
Best for research into next-generation antimicrobials against multidrug-resistant infections & topical antimicrobial development for wound infections with biofilm involvement
Best for
Research into next-generation antimicrobials against multidrug-resistant infections
Cathelicidin (hCAP-18 / Synthetic Derivatives) is particularly well-suited for individuals focused on research into next-generation antimicrobials against multidrug-resistant infections. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Topical antimicrobial development for wound infections with biofilm involvement
Cathelicidin (hCAP-18 / Synthetic Derivatives) is particularly well-suited for individuals focused on topical antimicrobial development for wound infections with biofilm involvement. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Understanding vitamin D-cathelicidin innate immune axis for immune optimization
Cathelicidin (hCAP-18 / Synthetic Derivatives) is particularly well-suited for individuals focused on understanding vitamin d-cathelicidin innate immune axis for immune optimization. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Development of anti-biofilm therapeutics for chronic device-related and wound infections
Cathelicidin (hCAP-18 / Synthetic Derivatives) is particularly well-suited for individuals focused on development of anti-biofilm therapeutics for chronic device-related and wound infections. Research and clinical experience suggest meaningful benefits in this area when used as part of a comprehensive treatment approach.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare Cathelicidin (hCAP-18 / Synthetic Derivatives) with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Topical application (primary research route) · Subcutaneous injection (preclinical)
Reconstitution — what you need
Example
Cathelicidin (hCAP-18 / Synthetic Derivatives) comes in pre-measured doses or forms. Follow the exact dosing instructions on your prescription label. No reconstitution or mixing is typically required for this formulation.
Use Cathelicidin (hCAP-18 / Synthetic Derivatives) exactly as prescribed. Each unit contains the labeled amount. Your healthcare provider will determine the appropriate dose based on your individual needs and response.
Route
Cathelicidin (hCAP-18 / Synthetic Derivatives) is administered Topical application (primary research route)—no injection required
Best sites
Technique
- 01Follow the specific administration instructions for your Cathelicidin (hCAP-18 / Synthetic Derivatives) formulation
- 02Take or apply as directed by your healthcare provider
- 03Store properly between uses according to package instructions
Storage · before reconstitution
Store Cathelicidin (hCAP-18 / Synthetic Derivatives) in the refrigerator at 36-46°F (2-8°C) in its original packaging. Protect from light and moisture. Do not freeze. Check the expiration date before use. Some formulations may be stored at room temperature for limited periods—check your specific product labeling.
Storage · after reconstitution
Once reconstituted, Cathelicidin (hCAP-18 / Synthetic Derivatives) should be kept refrigerated at 36-46°F (2-8°C) and used within the timeframe specified on your product labeling (typically 14-28 days). Label the vial with the reconstitution date. Do not use if the solution appears cloudy, discolored, or contains particles.
Signs of degradation
Sample daily schedule
05 · Safety
Is it safe?
3 common side effects · 2 serious
Cathelicidin peptides (natural and synthetic) are not FDA-approved and have no completed human clinical trials. Animal studies demonstrate broad-spectrum antimicrobial activity without systemic toxicity at therapeutic concentrations. However, concern exists regarding immunological tolerance—cathelicidin derivatives can trigger innate immune activation and inflammatory responses at high concentrations. The peptide's mechanism on immune cells is incompletely understood in humans, and effects on chronic immune signaling, tolerance development, or off-target immune activation remain uncharacterized. Bacterial resistance development to cathelicidin-based therapeutics is theoretically possible but not yet documented clinically.
Evidence is limited to in vitro antimicrobial activity assays, animal infection models, and preclinical immune cell studies. No human pharmacokinetics, dose-escalation studies, Phase 1 safety data, or clinical efficacy trials exist. Published research focuses on mechanism of antimicrobial action rather than safety profiling or tolerability in human use.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Severe or worsening side effects that don't improve with dose adjustment or supportive care
- ×Signs of an allergic reaction—rash, hives, swelling, or difficulty breathing
- ×Your healthcare provider recommends discontinuation based on your clinical response
- ×Development of any new medical condition that may be contraindicated with Cathelicidin (hCAP-18 / Synthetic Derivatives)
- ×Pregnancy or planning to become pregnant (unless specifically approved for use during pregnancy)
- ×Abnormal lab results or clinical markers that suggest adverse effects
Cathelicidin (hCAP-18 / Synthetic Derivatives) should only be started, adjusted, or discontinued under medical supervision. This information is for educational purposes only and does not replace professional medical advice. Never stop a prescribed treatment without consulting your healthcare provider first, as abrupt discontinuation may have consequences.
With other peptides
- ✓Vitamin D3 (directly upregulates CAMP gene expression and endogenous cathelicidin production through VDR activation — synergistic immune enhancement) — May be used together under medical guidance.
- ✓Conventional antibiotics (cathelicidin derivatives synergize with rifampicin, vancomycin, and gentamicin against biofilm infections — lowering effective antibiotic doses) — May be used together under medical guidance.
- ✓Silver wound dressings (complementary antimicrobial mechanisms — physical membrane disruption plus ion-mediated protein denaturation) — May be used together under medical guidance.
With medications
- !High concentrations of divalent cations (Mg²⁺, Ca²⁺) in formulations — may reduce electrostatic membrane binding of cationic cathelicidin peptides — Use with caution—discuss with your healthcare provider.
- !Anionic surfactants or high-concentration albumin solutions — may sequester cationic peptides and reduce bioavailability — Use with caution—discuss with your healthcare provider.
- !Immunosuppressive medications without supervision — cathelicidin derivatives promote immune activation that may conflict with immunosuppressive goals — Use with caution—discuss with your healthcare provider.
With supplements
- ✓Multivitamins — Generally safe to take alongside Cathelicidin (hCAP-18 / Synthetic Derivatives). Space doses apart if taking oral formulations to ensure optimal absorption.
- ✓Electrolyte supplements — Helpful if experiencing any GI side effects that could lead to dehydration. Safe to combine.
06 · Effectiveness
How do I know it's working?
Moderate human trials · first signs hours 0-24 (first application)
Evidence level
Moderate human trials
(Phase 1-2)
How it works
Cathelicidin (LL-37) is a natural antimicrobial peptide your immune cells produce to kill bacteria, viruses, and fungi. It also reduces inflammation and promotes wound healing, making it a multi-functional defender of your health.
Cathelicidin is a 37-amino acid cationic antimicrobial peptide synthesized primarily by neutrophils, epithelial cells, and other immune cells from the precursor hCAP18 following proteolytic cleavage. It exhibits broad-spectrum antimicrobial activity through multiple mechanisms: membrane disruption via formation of α-helical structures that insert into bacterial and fungal membranes, specific binding to lipopolysaccharides and lipoteichoic acids, and intracellular targeting of nucleic acids. Beyond antimicrobial functions, cathelicidin modulates innate immunity through TLR9 and G-protein coupled receptor signaling, promoting chemotaxis of immune cells, enhancing phagocytosis, and reducing pro-inflammatory cytokine production via NF-κB pathway suppression.
What to expect
Hours 0-24 (first application)
What you might notice
- •Rapid bactericidal activity begins within 30 minutes of application
- •Mild local redness and warmth at the application site
- •Increased wound exudate as biofilm matrix is disrupted
- •Visible reduction in wound bed bacterial burden (clinical observation)
What's normal
- •SAAP-148 achieves >99% killing of planktonic bacteria within 30 minutes
- •Biofilm disruption releases trapped bacteria and debris — increased exudate is expected
- •Local immune cell recruitment via FPR2/ALX begins within hours
- •Inflammatory response indicates active immune engagement
What's next
- →Continue daily application per research protocol
- →Biofilm eradication requires 2-4 hours of sustained exposure
- →Monitor wound appearance and exudate characteristics
- →Re-evaluate at 48-72 hours for evidence of reduced bacterial burden
Days 2-7 (active treatment phase)
What you might notice
- •Progressive reduction in wound infection signs (less erythema, reduced exudate, decreased odor)
- •Appearance of healthy granulation tissue as bacterial burden decreases
- •Reduced local inflammation as infection is controlled
- •Evidence of wound edge contraction and early epithelialization
What's normal
- •Biofilm eradication and bacterial clearance typically require 3-7 days of repeated application
- •Wound healing acceleration through keratinocyte migration stimulation and VEGF-mediated angiogenesis
- •Progressive improvement in wound bed appearance
- •Immune modulation shifts from pro-inflammatory (pathogen clearance) to pro-resolution (healing)
What's next
- →Continue treatment through the full planned protocol duration
- →Assess need for continued application based on wound culture results
- →Monitor for any emerging resistance (extremely unlikely with membrane-targeting mechanism)
- →Consider transition to maintenance dosing or conventional wound care once infection resolves
Week 2-4 (resolution and healing)
What you might notice
- •Wound infection fully resolved with negative cultures
- •Active wound healing with healthy granulation and epithelialization
- •Reduced need for continued antimicrobial treatment
- •Overall improvement in wound closure and tissue quality
What's normal
- •Cathelicidin-derived peptides support the full healing cascade from infection clearance to tissue repair
- •Low resistance emergence — multi-target membrane mechanism prevents bacterial adaptation
- •Transition from antimicrobial to predominantly wound-healing effects
- •Effects on immune cell recruitment and function continue supporting tissue regeneration
What's next
- →Transition to standard wound care once infection is cleared
- →Monitor for any recurrence at the treatment site
- →Document outcomes for research protocol analysis
- →Consider vitamin D optimization to support endogenous cathelicidin production long-term
Signs it's working · Treatment Response
- ✓Improvement in the primary symptoms or condition being treated
- ✓Positive changes in relevant lab values or clinical markers
- ✓Consistent, stable response to Cathelicidin (hCAP-18 / Synthetic Derivatives) over time
- ✓Reduction in symptom frequency or severity
Signs it's working · General Well-being
- ✓Improved energy levels and daily functioning
- ✓Better quality of life related to the treated condition
- ✓Manageable or absent side effects indicating good tolerance
- ✓Positive feedback from healthcare provider during check-ups
Not seeing results? Common reasons
- •Not at therapeutic dose yet—initial doses are for building tolerance, not maximum effect
- •Insufficient time at target dose—most compounds need several weeks to show full benefits
- •Inconsistent dosing schedule—regular, consistent use is crucial for optimal results
- •Individual variation in response—genetics, metabolism, and other factors affect outcomes
- •Underlying conditions or medications interfering with absorption or effectiveness
- •Improper storage leading to degraded product—always verify proper storage conditions
Key research
07 · Questions
Frequently asked
How is this cathelicidin entry different from the LL-37 entry on this site?+
LL-37 is the 37-amino-acid mature peptide cleaved from the cathelicidin precursor protein hCAP-18 by neutrophil proteinase 3. This cathelicidin entry focuses on the broader cathelicidin system — the hCAP-18 precursor protein, the vitamin D-regulated CAMP gene, and especially the next-generation synthetic derivatives SAAP-148 and OP-145 that were engineered to overcome LL-37's key limitation of losing antimicrobial activity under physiological conditions. SAAP-148 retains full potency in human plasma and physiological salt, while LL-37 does not.
What makes SAAP-148 better than LL-37 for clinical development?+
LL-37's major translational barrier is that it loses most of its antimicrobial activity in the presence of physiological salt concentrations (150 mM NaCl), serum proteins, and human plasma. SAAP-148 was specifically engineered at Leiden University Medical Center to solve this problem — through optimization of charge distribution (+11 vs LL-37's +6) and hydrophobic core stability, SAAP-148 maintains full bactericidal and anti-biofilm activity under physiological conditions. This means the concentrations that work in the lab actually work in human wound environments.
Why is vitamin D important for cathelicidin?+
The CAMP gene that encodes the cathelicidin precursor hCAP-18 has a vitamin D response element (VDRE) in its promoter region. When 1,25-dihydroxyvitamin D3 (active vitamin D) binds the vitamin D receptor, it directly upregulates CAMP gene transcription in neutrophils, macrophages, and epithelial cells. This means circulating 25-hydroxyvitamin D levels directly influence antimicrobial peptide production — explaining why vitamin D deficiency is associated with increased susceptibility to infections, particularly tuberculosis and respiratory infections.
Can bacteria develop resistance to cathelicidin-derived peptides?+
Resistance development is extremely unlikely with cathelicidin-derived peptides because they target the fundamental physical structure of bacterial membranes rather than a specific protein or metabolic pathway. The multi-target membrane disruption mechanism — involving electrostatic binding, lipid insertion, pore formation, and membrane depolarization — would require bacteria to completely restructure their membrane architecture, which is incompatible with viability. Serial passage experiments with SAAP-148 show no significant resistance development even after extended exposure.
What happened with the OP-145 clinical trial?+
OP-145 (also known as P60.4Ac), a 24-amino-acid cathelicidin-derived peptide with a +7 net charge, was evaluated in a Phase I/II clinical trial for chronic suppurative otitis media (CSOM) — chronic ear infections involving biofilms. The trial demonstrated that OP-145 ear drops were safe, well-tolerated, and showed efficacy against chronic biofilm infections that had failed conventional antibiotic therapy. This trial represented the first clinical validation of a synthetic cathelicidin derivative for treating human biofilm infections.
Is cathelicidin the same as the antimicrobial peptide found in sweat?+
Cathelicidin (LL-37 cleaved from hCAP-18) is indeed one of several antimicrobial peptides found in human sweat, alongside dermcidin and human beta-defensins. However, cathelicidin is much more broadly expressed — it is produced by neutrophils (stored in specific granules), macrophages, epithelial cells of the skin, respiratory tract, urinary tract, and gastrointestinal tract. Its expression in these barrier tissues makes it one of the body's first-line defenders against invading pathogens, well before adaptive immune responses engage.