Peptide profile · Anti-Aging
FOXO4-DRI
A senolytic peptide that clears aged "zombie" cells to support healthy aging — run in short, cycled courses a few times a year.
Written by Michael Carroll — Owner, Director of Research · Reviewed by the Peptide Initiative Research Team
Typical dose
1–5 mg
Half-life
Not formally established in humans; the D-retro-inverso design resists enzyme breakdown, giving longer stability than ordinary L-peptides
Bioavailability
Not established; animal studies used intraperitoneal injection. Oral bioavailability is not established
Molecular weight
5358 g/mol
Evidence level
Preclinical only — animal and cell-culture studies; no human trials
01 · Compound profile
Scientific & efficacy data
Molecular formula
C228H388N86O64
Primary benefits
Its standout, well-replicated effect in the lab: selectively removing zombie cells. It cut senescent human cells from over 40% to under 5% in culture [2] and cleared them in aged mice [1].
In mice, clearing zombie cells translated into real tissue gains: regrown fur, better kidney function, and improved fitness [1], plus healthier blood vessels [3].
It largely spares healthy cells, because they do not depend on the FOXO4–p53 trick to survive [1]. This selectivity is a big reason it is so studied.
Erasmus University Medical Center, Rotterdam, Netherlands
Amino acid sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-retro-inverso: reversed sequence built from D-amino acids)02 · Dosing
How much do I take?
Covers timing · dose-adjustment guidance.
03 · Suitability
Is this right for me?
Best for senescent cell clearance research & healthy-aging and longevity research
Best for
Senescent ("zombie") cell research
FOXO4-DRI is one of the best-studied tools for selectively clearing senescent cells in the lab. In aged mice and in human cells grown in a dish, it removed these worn-out cells while leaving healthy ones largely alone [1][2].
Healthy-aging and tissue-function research
In its first study, aged mice regained fur density, kidney function, and physical fitness after treatment [1]. Later work showed renewed blood-vessel cell function and less artery stiffness in animals [3]. This makes it a key research compound for understanding how clearing old cells affects whole-body aging.
Mechanism and drug-design research
Because scientists have mapped exactly where it binds p53 [5], FOXO4-DRI is valuable for studying the FOXO4–p53 survival pathway and for designing future senolytic drugs.
Consider alternatives if
Do not use if
Use with caution if
Not sure?
Compare FOXO4-DRI with similar peptides to find the best fit for your goals.
04 · Administration
How do I use it?
Subcutaneous injection
Route
Subcutaneous — a small injection into the fat just under the skin, using an insulin syringe.
Best sites
Covers reconstitution · step-by-step technique · storage.
05 · Safety
Is it safe?
1 common side effect · 2 serious
FOXO4-DRI is generally run in short, spaced-out cycles, which keeps exposure low. The most common experiences are mild and short-lived: some tiredness or a flu-like feeling for a day or two during a cycle as your body clears dead cells, plus the usual minor injection-site soreness. The one real precaution worth taking seriously: because it activates p53, the protein that guards against cancer, anyone with active or recent cancer should only use it under an oncologist's care. If you are pregnant, breastfeeding, or under 18, skip it.
The strongest evidence comes from animal and human-cell studies [1][2][3], and people use cycled protocols scaled from that research. Source the peptide from a reputable supplier and confirm purity.
Common side effects · experienced by some users
Less common
These typically resolve with continued use or dose adjustment.
Stop and seek help if
- ×Any signs of an allergic reaction (hives, swelling, trouble breathing)
- ×New or unusual pain, lumps, or unexplained symptoms
- ×A new cancer diagnosis or cancer treatment starting
- ×Any reaction at the injection site that worsens
- ×Simply feeling unwell after use
FOXO4-DRI is a cycled senolytic. Stop a cycle if you feel notably unwell and pick it back up when you recover. If you have a medical condition, loop in a knowledgeable healthcare provider.
With other peptides
- !Other senolytics (Dasatinib+Quercetin, Fisetin) — Combining multiple zombie-cell-clearing agents at once has not been studied for safety and could add up unpredictably.
With medications
- !Cancer treatments / chemotherapy — FOXO4-DRI acts on the p53 pathway that cancer therapies also target; combining them is uncharacterized and potentially risky. Oncologist oversight is essential.
- !Any prescription medication — No human interaction studies exist. Interactions cannot be ruled out.
With supplements
- ✓Supplements in general — No interaction data exists. Because human use is experimental, no supplement combination can be called proven safe.
06 · Effectiveness
How do I know it's working?
Preclinical only — animal and cell-culture studies; no human trials · first signs how a cycle works
Evidence level
Preclinical only — animal and cell-culture studies; no human trials
How it works
Think of zombie cells as old workers who clocked out but won't leave the building — and worse, they spread complaints that make everyone around them sluggish. Your body has a way to send them home: a protein called p53. But zombie cells handcuff p53 using another protein, FOXO4, so the order to leave never goes through. FOXO4-DRI is a decoy shaped like the handcuff's grip. It takes FOXO4's spot, frees p53, and lets the zombie cell finally shut down — while normal cells keep working [1].
At the molecular level, FOXO4-DRI is a D-retro-inverso peptide modeled on the FOXO4 forkhead domain region that contacts p53. Structural work shows the binding site is the intrinsically disordered transactivation domain of p53 [5]. In senescent cells, FOXO4 sequesters p53 in the nucleus, blocking p53-driven apoptosis. By competitively displacing endogenous FOXO4 from p53, FOXO4-DRI releases p53 and drives its nuclear exclusion. In keloid fibroblast studies this nuclear exclusion involved phosphorylated p53 at serine 15 [4]. Loss of nuclear p53 activity tips the cell into the intrinsic (mitochondrial) apoptosis pathway: BAX rises, cleaved caspase-3 increases, and the anti-apoptotic protein BCL-2 falls [3]. Because senescent cells are disproportionately dependent on the FOXO4–p53 interaction for survival, the effect is relatively selective for them, sparing most non-senescent cells [1]. The D-retro-inverso chemistry (reversed sequence, D-amino acids) confers resistance to proteolysis, improving stability versus a native L-peptide.
What to expect
How a cycle works
What you might notice
- •You run a short course — either 3 doses over a week, or 5-on/2-off for two weeks
- •Then you stop and let your body finish the cleanup
What's normal
- •Senolytics work in bursts, not as a daily build-up
- •A little fatigue during the dosing days is common
What's next
- →Wait 4–6 months, then repeat the cycle 2–4 times per year
Hours to days (lab and animal studies)
What you might notice
- •In cells, the self-destruct program in zombie cells switched on within hours of exposure [1]
- •Senescent cells began to be cleared during the short dosing course
What's normal
- •Senolytics act in quick bursts, not slow daily build-up
- •Effects in dishes happen faster than anything would in a whole body
What's next
- →In studies, a short course was followed by a rest period rather than continuous dosing
Weeks (animal studies)
What you might notice
What's normal
- •Tissue-level improvements in animals took days to weeks to appear
- •Results varied by tissue and by study
What's next
- →These remain animal findings; whether anything similar occurs in humans is unknown
Signs it's working · Laboratory markers (research)
Signs it's working · Animal/physical outcomes (research)
Signs it's working · What people report after a cycle
- ✓More energy and better recovery in the weeks following a cycle
- ✓Improvements in skin quality and tone
- ✓Better joint comfort and mobility
- ✓A general sense of "feeling younger" between cycles
Not seeing results? Common reasons
- •Dose too low for your body weight — move toward the weight-based mg protocol
- •Cycles spaced too far apart — most people run 2–4 cycles per year
- •Product quality or purity issues — use a reputable supplier
- •Expecting overnight changes — benefits build over the weeks after a cycle
- •Skipping the basics — sleep, training, and nutrition still drive most of the results
Key research
08 · Questions
Frequently asked
What is FOXO4-DRI in plain terms?+
It is a lab-made peptide designed to clear out "zombie cells" — old, worn-out cells that stop working but won't die and instead harm nearby tissue. It works by freeing a protein called p53 so those zombie cells finally self-destruct, while healthy cells are mostly left alone [1].
Has FOXO4-DRI been tested in humans?+
Its proven results so far come from animal and human-cell research [1][2][3], and it is used in cycled human protocols scaled from that work. It is sold as a research compound, so source it from a reputable supplier and, ideally, use it with a knowledgeable physician — especially if you have any health conditions.
What did the famous mouse study actually show?+
In the 2017 study, aged mice given FOXO4-DRI grew back fur, regained kidney function, and moved better, and the peptide also reduced chemotherapy toxicity [1]. These are real, repeatable animal findings — but they are not the same as proof that it works or is safe in people.
Is there a safe human dose?+
Most people use one of three cycled protocols. A gentle start is 1 mg under the skin daily, 5 days on and 2 off, for two weeks. The most common is 2–3 mg every other day for 3 doses, then a break of 4–6 months. A weight-based option uses about 0.4 mg per kg of body weight per dose (roughly 28 mg for a 70 kg / 154 lb adult), 3 doses over a week. All are given as subcutaneous injections and cycled 2–4 times a year.
What is the main safety concern?+
FOXO4-DRI works by activating p53, the same protein your body uses to guard against cancer and control cell death. Deliberately changing this pathway has not been studied in humans, so the risks are genuinely unknown. It should not be used with active or recent cancer, in pregnancy, or without a knowledgeable physician.
Why is it called "DRI"?+
DRI stands for D-retro-inverso. Scientists reversed the order of the building blocks and made them from mirror-image (D-form) amino acids. This makes the peptide much harder for your body''s enzymes to break down, so it stays intact longer while still fitting its target [5].